Biochemicals and Reagents

<p>Rabbit polyclonal DAP1 antibody (FITC)</p>

<p>Mouse monoclonal GSTO2 antibody</p>

<p>GSG1 antibody was raised using the C terminal of GSG1 corresponding to a region with amino acids VLEFKCKHSKSFKENPNCLPHHHQCFPRRLSSAAPTVGPLTSYHQYHNQP</p>

<p>Rabbit polyclonal SPG20 antibody</p>

<p>NUP98 antibody was raised using the N terminal of NUP98 corresponding to a region with amino acids EELRLEDYQANRKGPQNQVGAGTTTGLFGSSPATSSATGLFSSSTTNSGF</p>

<p>GSK3beta antibody was raised using the C terminal of GSK3B corresponding to a region with amino acids AIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDTPALFNF</p>

<p>Purified recombinant ARC protein (His tag)</p>

<p>Rabbit polyclonal SIN3A antibody</p>

<p>Archain 1 antibody was raised using the middle region of ARCN1 corresponding to a region with amino acids GGLQNMELHGMIMLRISDDKYGRIRLHVENEDKKGVQLQTHPNVDKKLFT</p>

<p>The MBP antibody is a monoclonal antibody that specifically targets the antigen known as epidermal growth factor (EGF). This antibody is widely used in Life Sciences research to study the role of EGF in various biological processes. It has been shown to have neutralizing activity against EGF, inhibiting its binding to receptors and blocking downstream signaling pathways. Additionally, the MBP antibody has been used to detect and quantify EGF levels in samples, making it a valuable tool for researchers studying growth factors and their effects. With its high specificity and affinity, this monoclonal antibody offers reliable and accurate results. It is formulated with excipients to ensure stability and long shelf life. The MBP antibody is suitable for use in various applications such as ELISA, Western blotting, immunohistochemistry, and flow cytometry.</p>

<p>The His Tag antibody is a low-molecular-weight antibody that is widely used in Life Sciences research. It specifically recognizes and binds to the histidine-tagged proteins, which are commonly used as fusion partners in recombinant protein expression systems. The structural formula of the His Tag antibody allows it to easily bind to the activated histidine residues on the target proteins.</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an antituberculosis drug that falls under the class of rifamycins. It is known for its bactericidal activity against tuberculosis infection. This active compound works by inhibiting bacterial growth through its binding to DNA-dependent RNA polymerase, preventing transcription and replication. It has been extensively studied using a patch-clamp technique on human erythrocytes, demonstrating its high frequency of human activity. The drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically binds to markers expressed in Mycobacterium tuberculosis strains and inhibits cell growth in culture.</p>

<p>CTCF antibody was raised in Rat using Mouse CTCF-C-terminal fragment as the immunogen.</p>

<p>The Tropomyosin antibody is a highly specialized monoclonal antibody that has neutralizing, cytotoxic, and growth factor properties. It is commonly used in Life Sciences research and as an immunomodulatory agent in the development of anticancer agents. This monoclonal antibody specifically targets tropomyosin, a glycoprotein involved in cell motility and muscle contraction.</p>

<p>IFN beta antibody was raised in mouse using human interferon gamma as the immunogen.</p>

<p>PAX8 antibody was raised in mouse using recombinant Paired Box Gene 8</p>

<p>SGCB antibody was raised using a synthetic peptide corresponding to a region with amino acids FSTDYETHEFHLPSGVKSLNVQKASTERITSNATSDLNIKVDGRAIVRGN</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is specifically designed to combat tuberculosis infections by targeting active compounds and exhibiting bactericidal activity. The drug works by binding to DNA-dependent RNA polymerase, effectively preventing transcription and replication, thus inhibiting bacterial growth. Its efficacy has been demonstrated through extensive testing using the patch-clamp technique on human erythrocytes. Additionally, this drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Moreover, it possesses the unique ability to bind to markers expressed at high levels in Mycobacterium tuberculosis strains and inhibit their cell growth in culture.</p>

<p>YIPF1 antibody was raised using the middle region of YIPF1 corresponding to a region with amino acids HLGEKTYHYVPEFRKVSIAATIIYAYAWLVPLALWGFLMWRNSKVMNIVS</p>

<p>IL6 antibody is a monoclonal antibody that specifically targets interleukin-6 (IL-6), a cytokine involved in various inflammatory processes. This antibody has been developed as a therapeutic agent for the treatment of conditions associated with IL-6 overexpression, such as rheumatoid arthritis and certain types of cancer. IL6 antibody works by binding to IL-6 and neutralizing its activity, thereby reducing inflammation and inhibiting tumor growth. It has been shown to have high specificity and affinity for IL-6, making it an effective tool for immunoassays in Life Sciences research. Additionally, IL6 antibody can be used in vitro to measure IL-6 levels in biological samples, providing valuable insights into disease progression and response to treatment. With its unique properties and potential therapeutic applications, IL6 antibody is a valuable tool for researchers and clinicians alike.</p>

<p>PARP16 antibody was raised using a synthetic peptide corresponding to a region with amino acids KRDSVLRPFPASYARGDCKDFEALLADASKLPNLKELLQSSGDNHKRAWD</p>

<p>Rabbit polyclonal SDCBP2 antibody</p>

<p>Resistin antibody was raised in mouse using highly pure recombinant human resistin as the immunogen.</p>

<p>SIGLEC7 antibody was raised using the middle region of SIGLEC7 corresponding to a region with amino acids WRSLTLYPSQPSNPLVLELQVHLGDEGEFTCRAQNSLGSQHVSLNLSLQQ</p>

<p>Mouse monoclonal FAA antibody</p>

<p>MRPL48 antibody was raised using the middle region of MRPL48 corresponding to a region with amino acids KKGKVEVRAINLGTDYEYGVLNIHLTAYDMTLAESYAQYVHNLCNSLSIK</p>

<p>Mouse monoclonal Alphavirus Group antibody</p>

<p>Androgen receptor antibody was raised in rabbit using a synthetic peptide corresponding to residues M(1) E V Q L G L G R V Y P R P P S K T Y R G(21) C of human androgen receptor as the immunogen.</p>

<p>Keratin K18 antibody was raised in mouse using human keratin preparation as the immunogen.</p>

<p>Carbamazepine Conjugate for use in immunoassays</p>

<p>The Measles virus protein is a multifunctional protein that exhibits various characteristics. It has insulin-like properties and can interact with alpha-fetoprotein, a growth factor involved in fetal development. Monoclonal antibodies can be used to target this protein for research purposes. Additionally, it has natriuretic properties, meaning it affects the balance of sodium and water in the body. The Measles virus protein also plays a role in fatty acid metabolism and telomerase activity, which is important for maintaining the integrity of DNA. It has been found to localize in the nucleus and may have implications in nuclear processes. Furthermore, it interacts with brain natriuretic peptide and antibodies against this protein can be used as diagnostic tools. If you're looking for Native Proteins &amp; Antigens or acidic growth factor-1 receptor-related products, the Measles virus protein may be of interest to you. Explore our range of Proteins and Antigens to find products related to this</p>

<p>The SMARCA4 antibody is a monoclonal antibody used in the field of Life Sciences. It is a medicament that targets and binds to SMARCA4, a protein involved in various cellular processes such as DNA repair and gene regulation. The SMARCA4 antibody has been shown to be activated upon binding, leading to downstream effects such as the inhibition of phosphatase activity and the promotion of growth factor signaling. Additionally, this antibody has demonstrated its ability to interact with other proteins like fibrinogen, lipoprotein lipase, and collagen, suggesting its potential role in modulating cell-matrix interactions. With its specificity and versatility, the SMARCA4 antibody is an invaluable tool for researchers studying epidermal growth factors, histidine metabolism, and carbamazepine response pathways.</p>

<p>Rabbit polyclonal RAB41 antibody</p>

<p>The ACSS2 antibody is a highly specialized product in the field of Life Sciences. It belongs to the category of monoclonal antibodies and is specifically designed to target and inhibit the activity of the macrophage colony-stimulating factor (CSF). This antibody has been extensively tested and proven effective in various research studies.</p>

<p>The Moesin antibody is a highly specialized monoclonal antibody used in Life Sciences research. It plays a crucial role in studying growth factors, binding proteins, and various cellular processes. This antibody is widely used in electrode-based experiments to study the interaction between specific proteins and their targets. Additionally, it has been utilized to investigate the role of Moesin in androgen signaling pathways. The Moesin antibody is also employed in the detection of autoantibodies present in human serum samples. With its high specificity and sensitivity, this antibody is an essential tool for researchers working on protein analysis and understanding complex cellular mechanisms.</p>

<p>The EID3 antibody is a highly effective biomolecule used in the field of Life Sciences. This activated antibody specifically targets and binds to tumor necrosis factor-alpha (TNF-α), a key player in inflammatory responses. It is available in both monoclonal and polyclonal forms, ensuring versatility for various research applications.</p>

<p>The IgM antibody is a monoclonal antibody used in the field of Life Sciences. It is specifically designed to detect and bind to a recombinant antigen, making it an invaluable tool for research and diagnostic purposes. This antibody is colloidal in nature, allowing for easy detection and visualization of the target antigen.</p>

<p>KCNN3 antibody was raised using the C terminal of KCNN3 corresponding to a region with amino acids ITELNDRSEDLEKQIGSLESKLEHLTASFNSLPLLIADTLRQQQQQLLSA</p>

<p>LGALS8 antibody was raised using a synthetic peptide corresponding to a region with amino acids FPFSPGMYFEMIIYCDVREFKVAVNGVHSLEYKHRFKELSSIDTLEINGD</p>

<p>Rabbit polyclonal PLCG1 antibody</p>

<p>Mouse monoclonal Citrate Lyase antibody (C-terminus)</p>

<p>The Sumo1 antibody is a polyclonal antibody that is used for the immobilization of human serum on an electrode. It is commonly used in research and laboratory settings to study the binding proteins and inhibitors involved in various cellular processes. This antibody has also been shown to have neutralizing effects on interferon, making it a valuable tool in immunology research. Additionally, the Sumo1 antibody has demonstrated neuroprotective properties and has been investigated for its potential use in treating neurodegenerative disorders. However, it is important to note that this antibody may have teratogenic effects and should be handled with caution. In the field of Life Sciences, the Sumo1 antibody plays a crucial role in understanding cellular pathways and protein interactions.</p>

<p>Rabbit polyclonal PYGB antibody</p>

<p>Mouse monoclonal FAM40A antibody</p>

<p>GSTA4 antibody was raised using the C terminal of GSTA4 corresponding to a region with amino acids LSAFPFLQEYTVKLSNIPTIKRFLEPGSKKKPPPDEIYVRTVYNIFRP</p>

<p>Chymotrypsin is a protease that hydrolyses proteins by cleaving the peptide bond at the carboxyl side of the aromatic amino acids (Phenylalanine, Tyrosine or Tryptophan). Chemotrypsin belongs to a family of serine proteases, as it has a serine in its active site.</p>

<p>AATF antibody was raised in mouse using recombinant Apoptosis Antagonizing Transcription Factor</p>

<p>App antibody was raised in rabbit using the C terminal of App as the immunogen</p>

<p>Mouse monoclonal CDKN3 antibody</p>

<p>Purified Polyclonal HMGN1 antibody</p>

<p>Purified Polyclonal Basonuclin antibody</p>

<p>Alpha-1 trypsin antibody was raised in goat using human alpha-1-anti-trypsin as the immunogen.</p>

<p>Purified Rabbit polyclonal p70 S6 Kinase antibody (Ser371)</p>

<p>PCNP antibody was raised using the middle region of PCNP corresponding to a region with amino acids AKMRMKNIGRDTPTSAGPNSFNKGKHGFSDNQKLWERNIKSHLGNVHDQD</p>

<p>Guinea Pig Red Blood Cells (GPRBC) are widely used in veterinary applications and life sciences research. They serve as a growth factor for various experiments and studies. GPRBC can be stored in glycerin, ensuring their longevity and usability. These red blood cells have been utilized in research on choroidal neovascularization, hemolytic activities, receptor binding, and neutralizing monoclonal antibodies. GPRBC have also been studied for their role in the metabolism of cyp2a6 and racemase enzymes in human serum. With their diverse applications and significant contributions to scientific research, Guinea Pig Red Blood Cells are an essential resource for researchers in the field of life sciences.</p>

<p>Mouse monoclonal CALCA antibody</p>

<p>Mouse monoclonal RABL2A antibody</p>

<p>Rabbit polyclonal REG1B antibody</p>

<p>CFI-400437 is a peptide that binds to the beta2 subunit of the nicotinic acetylcholine receptor. It has been shown to inhibit the activity of this receptor and is used as a research tool for studying the effects of nicotinic acetylcholine receptors on life science, pharmacology, and cell biology. CFI-400437 has also been shown to be a high purity inhibitor of ion channels.</p>

<p>GMCSF antibody was raised in Rat using recombinant human GM-CSF as the immunogen.</p>

<p>Purified recombinant JDP2 protein (His tag)</p>

<p>YIPF6 antibody was raised using the C terminal of YIPF6 corresponding to a region with amino acids MVRLFVVIVMFAWSIVASTALLADSQPPNRRALAVYPVFLFYFVISWMIL</p>

<p>GSTM2 antibody was raised using a synthetic peptide corresponding to a region with amino acids TQSNAILRYIARKHNLCGESEKEQIREDILENQFMDSRMQLAKLCYDPDF</p>

<p>Purified Rabbit polyclonal PIPOX antibody</p>

<p>The ABL1 antibody is a monoclonal antibody that specifically targets the growth factor receptor ABL1. This biomolecule plays a crucial role in cell growth, division, and survival. The ABL1 antibody is designed to bind to the activated form of ABL1, neutralizing its function and preventing further downstream signaling.</p>

<p>TOP2B antibody was raised in rabbit using the middle region of TOP2B as the immunogen</p>

<p>Rabbit polyclonal PIAS3 antibody</p>

<p>Mouse monoclonal MAGEB18 antibody</p>

<p>Mouse monoclonal TAB1 antibody (N-terminus)</p>

<p>Rabbit polyclonal IQCB1 antibody</p>

<p>Rabbit polyclonal SCN5A antibody</p>

<p>Rabbit Polyclonal OR5P2 antibody</p>

<p>GAL3ST3 antibody was raised using the C terminal of GAL3ST3 corresponding to a region with amino acids VDIMGYDLPGGGAGPATEACLKLAMPEVQYSNYLLRKQKRRGGARARPEP</p>

<p>Rabbit polyclonal RNF133 antibody</p>

<p>Rabbit polyclonal SCPX antibody</p>

<p>PDE3A antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>Morphine/Oxycodone antibody was raised in mouse using Oxycodone-BSA as the immunogen.</p>

<p>The ZFP36 antibody is a highly effective neutralizing agent that targets the TGF-beta protein. This monoclonal antibody contains histidine and is designed to inhibit the function of TGF-beta, a key molecule involved in various cellular processes. It acts as a potent family kinase inhibitor, blocking the activity of target molecules and preventing their downstream effects.</p>

<p>The BMPR2 antibody is a highly specialized monoclonal antibody used in Life Sciences. It is designed to target and bind to the BMPR2 protein, which plays a crucial role in various cellular processes. This antibody is widely used in research and diagnostic applications due to its ability to detect and quantify the expression of BMPR2.</p>

<p>GPR21 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>Rabbit polyclonal HRH3 antibody</p>

<p>Rabbit polyclonal RBM14 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF529 antibody, catalog no. 70R-8358</p>

<p>Rabbit polyclonal GBAP antibody</p>

<p>Mouse monoclonal ATP5B antibody</p>

<p>Purified Rabbit polyclonal EFCAB1 antibody</p>

<p>The IL17 antibody is a monoclonal antibody that targets the colony-stimulating factor, activated. It is widely used in the field of Life Sciences for research purposes. This antibody specifically binds to IL17, a cytokine that plays a crucial role in immune response and inflammation. By blocking the interaction between IL17 and its receptors, this antibody inhibits the downstream signaling pathways, leading to a reduction in inflammation. Additionally, the IL17 antibody has been shown to have potential therapeutic applications in various diseases such as rheumatoid arthritis and psoriasis. With its high specificity and potency, this antibody is an essential tool for researchers studying cytokine biology and developing novel therapies.</p>

<p>Purified recombinant Human CNDP2 protein (His tag)</p>

<p>Armenian Hamster monoclonal CD3 antibody (PE)</p>

<p>NAT8B antibody was raised using a synthetic peptide corresponding to a region with amino acids SCFWVGESEEKVVGTVGALPVDDPTLREKRLQLFHLSVDNEHRGQGIAKA</p>

<p>6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is specifically designed to combat tuberculosis infections by targeting active compounds and exhibiting bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, effectively preventing transcription and replication, thus inhibiting bacterial growth. Remarkably, its high efficacy has been demonstrated through extensive testing using the patch-clamp technique on human erythrocytes.</p>

<p>POLD2 antibody was raised using a synthetic peptide corresponding to a region with amino acids LREVSEEHNLLPQPPRSKYIHPDDELVLEDELQRIKLKGTIDVSKLVTGT</p>

<p>Purified Polyclonal MRPS27 antibody</p>

<p>The CD1b antibody is a monoclonal antibody that targets the CD1b protein, which plays a crucial role in immune responses and cell growth. This antibody has been extensively studied in the field of Life Sciences and has shown promising results in various applications.</p>

<p>The TUBA1C antibody is a growth factor that has been extensively studied in the field of Life Sciences. It has shown promising results as a potential multidrug and interferon therapy. This antibody has demonstrated the ability to inhibit the effects of ketamine and vasoactive intestinal peptide, both of which are involved in various physiological processes. Additionally, it has been found to have neutralizing properties against epidermal growth factor and collagen, making it a valuable tool in research and therapeutic applications. The TUBA1C antibody is available as a high-quality monoclonal antibody that has been tested for its efficacy and specificity. It can be used in various experimental techniques, including low-molecular-weight electrode assays and immunohistochemistry. Researchers and scientists can rely on this antibody to provide accurate and reliable results in their studies.</p>

<p>Purified recombinant DUSP26 protein (His tag)</p>

<p>Purified Polyclonal HECW2 antibody</p>

<p>The Furazolidone monoclonal antibody is a highly specialized and targeted therapeutic agent used in the field of Life Sciences. This monoclonal antibody specifically targets extracellular substances found in blood plasma, making it a valuable tool in various medical applications. It has shown promising results in the treatment of leukemia and other related conditions.</p>

<p>Mouse monoclonal UBOX5 antibody</p>

<p>EPHB3 antibody is a glycoprotein that belongs to the family of binding proteins. It is a polyclonal antibody that can specifically target and bind to EPHB3, a receptor protein involved in various cellular processes. This antibody has been shown to have neutralizing properties against interferon and autoantibodies. Additionally, EPHB3 antibody can inhibit the activity of chemokines and multidrug resistance proteins, making it a valuable tool in life sciences research. It has also demonstrated reactivity against antiviral agents and extracellular histones. Furthermore, this antibody has shown potential as an anticancer agent, with studies indicating its effectiveness in suppressing cell growth and inducing apoptosis in HL-60 cells.</p>

<p>The ITGAV antibody is a monoclonal antibody that belongs to the class of human immunoglobulins. It specifically targets and binds to the ITGAV protein, which is involved in various cellular processes such as cell adhesion, migration, and signaling. This antibody has been shown to have neutralizing effects on chemokines, steroids, growth hormone receptors, and interferons.</p>

<p>The Human Growth Hormone antibody is a reactive monoclonal antibody that specifically targets and neutralizes the human serum albumin protein. This antibody has been extensively studied in the field of Life Sciences and has shown potential therapeutic applications. It can be used to inhibit the activity of growth hormone or other agonist proteins, making it an important tool for research and development.</p>

<p>RDH16 antibody was raised using a synthetic peptide corresponding to a region with amino acids SKERFLKSFLEIWDRSSPEVKEAYGEKFVADYKKSAEQMEQKCTQDLSLV</p>

<p>Rabbit polyclonal SMARCC1 antibody</p>

<p>Mouse monoclonal EXOSC7 antibody</p>

<p>Mouse monoclonal ELK3 antibody</p>

<p>Purified recombinant PET117 protein (His tag)</p>

<p>AMA1 protein is a key component in the field of Life Sciences. It is involved in various processes, including adipose activation and creatine kinase activity. This protein can be found in human serum and plays a crucial role in the apical membrane function. The AMA1 protein can be immobilized using an electrode and has been studied in relation to sorafenib treatment. Recombinant forms of this protein, along with specific monoclonal antibodies, are widely used in research and diagnostic applications. Additionally, AMA1 protein has been found to interact with collagen, further highlighting its importance in cellular processes.</p>

<p>Mouse Monoclonal ACAT2 antibody</p>

<p>Normal Pig Serum is a high-quality serum that is widely used in the Life Sciences and Veterinary Applications. It is derived from healthy pigs and contains a variety of important components, including glycosylation inhibitors, chemokine binding proteins, and oligodeoxynucleotides. This serum is particularly valuable for researchers working with monoclonal antibodies, as it provides an optimal environment for antibody production and stability.</p>

<p>ATXN2 antibody was raised in rabbit using the middle region of ATXN2 as the immunogen</p>

<p>The NMT2 antibody is a highly specialized biological agent that has a range of important applications in the field of Life Sciences. This antibody is known for its high bioavailability and exceptional binding affinity to erythropoietin receptors. It has been extensively studied for its ability to modulate various biological effects, including angiogenic response and the production of polyunsaturated fatty acids such as arachidonic acid.</p>

<p>MTCH1 antibody was raised using a synthetic peptide corresponding to a region with amino acids NNCGLQAGLPPYSPVFKSWIHCWKYLSVQGQLFRGSSLLFRRVSSGSCFA</p>

<p>The CD70 antibody is a monoclonal antibody that targets the CD70 protein. It has been shown to inhibit the activity of phosphatase and nuclear factor kappa-light-chain-enhancer in B cells, leading to decreased polymerase activity and growth factor activation. This antibody also has cytotoxic effects on mycoplasma genitalium, as it activates endonuclease and caspase-9, resulting in cell death. The CD70 antibody is widely used in Life Sciences research and has potential applications in the development of targeted therapies for various diseases.</p>

<p>LRRTM4 antibody was raised using the middle region of LRRTM4 corresponding to a region with amino acids FYWLKNFKGNKESTMICAGPKHIQGEKVSDAVETYNICSEVQVVNTERSH</p>

<p>Mouse monoclonal MGRN1 antibody</p>

<p>OSGIN1 antibody was raised using the N terminal of OSGIN1 corresponding to a region with amino acids APGVSILDQDLDYLSEGLEGRSQSPVALLFDALLRPDTDFGGNMKSVLTW</p>

<p>The NEK6 antibody is a highly specialized monoclonal antibody that is used in various applications within the Life Sciences field. It is designed to target and bind to NEK6, an enzyme involved in cell cycle regulation and signaling pathways. This antibody has been extensively tested and validated for its specificity and sensitivity.</p>

<p>RAB5B antibody was raised using the N terminal of RAB5B corresponding to a region with amino acids MTSRSTARPNGQPQASKICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQE</p>

<p>Rabbit polyclonal MYPT1 antibody (Thr696)</p>

<p>C12orf11 antibody was raised in Rabbit using Human C12orf11 as the immunogen</p>

<p>RDH11 antibody was raised using a synthetic peptide corresponding to a region with amino acids SFFIKTPQQGAQTSLHCALTEGLEILSGNHFSDCHVAWVSAQARNETIAR</p>

<p>Rat monoclonal IL4 antibody (allophycocyanin)</p>

<p>Mouse monoclonal TULP3 antibody</p>

<p>Esrrg antibody was raised in rabbit using the middle region of Esrrg as the immunogen</p>

<p>Rat lymphocyte antibody was raised in rabbit using RBC-free rat thymus and spleen cells as the immunogen.</p>

<p>Rabbit polyclonal SSB antibody (Ser366)</p>

<p>The EPHA5 antibody is a highly specialized antibody that targets the epidermal growth factor. It plays a crucial role in various Life Sciences applications, particularly in the study of adipose tissues. This antibody has been shown to affect important cellular processes such as glycosylation and cell adhesion through its interaction with proteins like E-cadherin and β-catenin.</p>

<p>Mouse monoclonal TTC32 antibody</p>

<p>The IGJ antibody is a specific antibody that targets the immunoglobulin J (IGJ) protein. This protein is involved in the production and secretion of antibodies in the body. The IGJ antibody has been extensively studied and validated using various techniques such as transcription-polymerase chain reaction (PCR), enzyme labeling, particle chemiluminescence, and more. It has been shown to have high affinity and specificity for the IGJ protein, making it an ideal tool for research and diagnostic applications. Additionally, this monoclonal antibody has neutralizing properties, allowing it to inhibit the activity of the IGJ protein. With its low density and ability to detect IGJ in human serum at low plasma levels, this antibody is a valuable asset for any laboratory or research facility working with immunoglobulins.</p>

<p>Purified Rabbit polyclonal OR5W2 antibody</p>

<p>Mouse monoclonal C5a desArg antibody</p>

<p>FKBP3 antibody was raised using the C terminal of FKBP3 corresponding to a region with amino acids EALLTMSKGEKARLEIEPEWAYGKKGQPDAKIPPNAKLTFEVELVDID</p>

<p>TNF alpha antibody was raised in rabbit using highly pure recombinant human TNF-alpha as the immunogen.</p>

<p>Mouse monoclonal Bt Cry1F antibody</p>

<p>Armenian Hamster monoclonal CD80 antibody (biotin)</p>

<p>Rabbit polyclonal BMP3 antibody</p>

<p>Rabbit polyclonal REC8 antibody</p>

<p>The PRDX4 antibody is a highly specific monoclonal antibody that targets and binds to peroxiredoxin-4 (PRDX4), an important antioxidant enzyme. This antibody is widely used in life sciences research to study the role of PRDX4 in various cellular processes.</p>

<p>UBN1 antibody was raised in mouse using recombinant Ubinuclein 1 (Ubn1)</p>

<p>Rabbit Polyclonal SOX9 antibody (Ser181)</p>

<p>LOC652618 antibody was raised using the N terminal Of Loc652618 corresponding to a region with amino acids MAGRSGHVDVVNERRLKPLYDNLDNGNYKMALQAADKLLKKHKDLHCAKV</p>

<p>The p22 phox antibody is a highly reactive nuclear antibody that targets the p22 phox protein. This protein plays a crucial role in the activation of the p38 mitogen-activated protein kinase (MAPK) pathway, which is involved in various cellular processes. The p22 phox antibody is widely used in Life Sciences research to study the regulation of this pathway and its implications in different biological contexts.</p>

<p>The ID3 antibody is a monoclonal antibody used in the field of Life Sciences. It specifically targets the ID3 receptor, which plays a crucial role in various biological processes such as collagen synthesis and receptor binding. This monoclonal antibody has been extensively studied for its potential therapeutic applications, including the treatment of autoimmune diseases and viral infections.</p>

<p>LARS antibody was raised in Rabbit using Human LARS as the immunogen</p>

<p>ACAT1 antibody was raised using a synthetic peptide corresponding to a region with amino acids SYTRSKAAWEAGKFGNEVIPVTVTVKGQPDVVVKEDEEYKRVDFSKVPKL</p>

<p>Recombinant Human AGA protein (His tag)</p>

<p>PPM1B antibody is a monoclonal antibody that specifically targets the protein phosphatase 1B (PPM1B). This antibody has been shown to be activated by alpha-fetoprotein and can be used for various applications in life sciences research. PPM1B plays a crucial role in regulating cellular processes such as fatty acid metabolism, adipose tissue development, and nuclear growth factor signaling. The PPM1B antibody can be used for studying the function of PPM1B in these processes and as an inhibitor to block its activity. Additionally, this antibody can be used in antibody-drug conjugates or as a tool for detecting c-myc antigen or epidermal growth factor receptors.</p>

<p>Purified recombinant rpmC protein (His tag)</p>

<p>Purified recombinant MUG protein (His tag)</p>

<p>Rabbit polyclonal RBM4B antibody</p>

<p>Rabbit polyclonal TNNT1 antibody</p>

<p>1-264 amino acids: MGSSHHHHHH SSGLVPRGSH MESGFTSKDT YLSHFNPRDY LEKYYKFGSR HSAESQILKH LLKNLFKIFC LDGVKGDLLI DIGSGPTIYQ LLSACESFKE IVVTDYSDQN LQELEKWLKK EPEAFDWSPV VTYVCDLEGN RVKGPEKEEK LRQAVKQVLK CDVTQSQPLG AVPLPPADCV LSTLCLDAAC PDLPTYCRAL RNLGSLLKPG GFLVIMDALK SSYYMIGEQK FSSLPLGREA VEAAVKEAGY TIEWFEVISQ SYSSTMANNE GLFSLVARKL SRPL</p>

<p>The TMOD1 antibody is a monoclonal antibody that has neutralizing properties against fibrinogen. It can be used in various applications, including electrode coating, human serum analysis, and anticoagulant therapies. This antibody specifically targets TMOD1, a protein involved in regulating actin filament dynamics. By binding to TMOD1, the antibody prevents its interaction with actin filaments, leading to the inhibition of cell motility and migration. Additionally, the TMOD1 antibody has been shown to have activated properties against certain cancer cells such as MCF-7 and can be used as a potential therapeutic molecule drug. With its high specificity and efficacy, this monoclonal antibody is a valuable tool for researchers and clinicians in studying various biological processes and developing novel treatments.</p>

<p>Rabbit polyclonal BTBD2 antibody (HRP)</p>

<p>DHCR24 antibody was raised using the N terminal of DHCR24 corresponding to a region with amino acids FLLPLSLIFDIYYYVRAWVVFKLSSAPRLHEQRVRDIQKQVREWKEQGSK</p>

<p>CAPRIN1 antibody was raised in Rabbit using Human CAPRIN1 as the immunogen</p>

<p>The SAA antibody is a highly specialized monoclonal antibody that targets the glial fibrillary acidic protein (GFAP). It has been extensively used in Life Sciences research to study the role of GFAP in various cellular processes. The antibody specifically recognizes the amino group of GFAP and can be used for applications such as immunohistochemistry, immunofluorescence, and Western blotting.</p>

<p>alpha Tubulin 4A antibody was raised using the middle region of TUBA4A corresponding to a region with amino acids YAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGIDSYEDEDEGEE</p>

<p>Rabbit polyclonal TAF9B antibody</p>

<p>Mouse monoclonal JEV ED3 antibody</p>

<p>CDKL2 antibody was raised using a synthetic peptide corresponding to a region with amino acids MEKYENLGLVGEGSYGMVMKCRNKDTGRIVAIKKFLESDDDKMVKKIAMR</p>

<p>KLF4 antibody was raised in mouse using recombinant human kLF4 (1-170aa) purified from E. coli as the immunogen.</p>

<p>GPR161 antibody was raised using the middle region of GPR161 corresponding to a region with amino acids  SISNRITDLGLSPHLTALMAGGQPLGHSSSTGDTGFSCSQDSGTDMMLLE</p>

<p>ABHD7 antibody was raised using the N terminal of ABHD7 corresponding to a region with amino acids HCYVRIKDSGLRFHYVAAGERGKPLMLLLHGFPEFWYSWRYQLREFKSEY</p>

<p>CHIA antibody was raised using the middle region of CHIA corresponding to a region with amino acids GSWEGYTGENSPLYKYPTDTGSNAYLNVDYVMNYWKDNGAPAEKLIVGFP</p>

<p>The Emerin Antibody is a highly specialized antibody used in various scientific and medical research applications. This antibody specifically targets the human protein Emerin, which plays a crucial role in cell structure and function. By binding to Emerin, this antibody allows for the detection and analysis of this protein in various samples.</p>

<p>The CHK2 antibody is a potent family kinase inhibitor that is widely used in Life Sciences research. It is known for its inhibitory properties against growth factors and interferons, making it a valuable tool in studying cell signaling pathways. This antibody has cytotoxic effects on cancer cells and has been shown to inhibit the activity of phosphatases, which play a crucial role in regulating cellular processes. The CHK2 antibody is available in both polyclonal and monoclonal forms, allowing researchers to choose the best option for their specific experiments. Its inhibitory properties extend to β-catenin, a key protein involved in cell adhesion and Wnt signaling pathways. With its wide range of applications, the CHK2 antibody is an essential tool for researchers in various fields of study.</p>

<p>ATG4A antibody was raised using a synthetic peptide corresponding to a region with amino acids PQSLGALGGKPNNAYYFIGFLGDELIFLDPHTTQTFVDTEENGTVNDQTF</p>

<p>Rabbit polyclonal CLNS1A antibody</p>

<p>LTA4H antibody was raised in Rabbit using Human LTA4H as the immunogen</p>

<p>Purified Rabbit polyclonal CDYL2 antibody</p>

<p>Rabbit polyclonal MIF antibody (HRP)</p>

<p>The NMT2 antibody is a highly specific monoclonal antibody that is derived from a hybridoma cell line. It targets the chemokine NMT2, a glycoprotein that is activated in certain disease conditions. This antibody has been extensively studied and has shown great potential as a therapeutic agent in various medical applications.</p>

<p>Rabbit polyclonal SPAG6 antibody</p>

<p>Mouse monoclonal EPM2AIP1 antibody</p>

<p>Purified recombinant ZNRD1 protein (His tag)</p>

<p>The AQP1 antibody is a highly activated steroid monoclonal antibody that is commonly used in the field of Life Sciences. It specifically targets the AQP1 protein, which plays a crucial role in regulating water transport across cell membranes. This antibody can be used for various applications, including Western blotting, immunohistochemistry, and flow cytometry.</p>

<p>The UCHL1 protein is a multifunctional protein that plays a crucial role in various biological processes. It has been extensively studied in the field of Life Sciences and has shown promising applications in different areas.</p>

<p>COX10 antibody was raised using the middle region of COX10 corresponding to a region with amino acids APGPFDWPCFLLTSVGTGLASCAANSINQFFEVPFDSNMNRTKNRPLVRG</p>

<p>Purified recombinant MUP1 protein (His tag)</p>