Biochemicals and Reagents

<p>KIAA1191 antibody was raised in Rabbit using Human KIAA1191 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SPAG4L antibody, catalog no. 70R-4453</p>

<p>The RRP1 antibody is a highly specialized antibody used in the field of life sciences. It is primarily used for research purposes and is commonly employed in studies related to atypical hemolytic disorders. This antibody specifically targets the RRP1 antigen, which is found in human serum and has been linked to various cellular processes.</p>

<p>MTMR15 antibody was raised in Rabbit using Human MTMR15 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SPAG6 antibody, catalog no. 70R-9257</p>

<p>The Leptin Receptor antibody is a monoclonal antibody used in Life Sciences research. It acts as a growth factor by binding to the leptin receptor, which plays a crucial role in regulating energy balance and body weight. This antibody can be used in various applications such as immunohistochemistry, western blotting, and flow cytometry. It is highly specific and has been validated for use in human samples. Additionally, this antibody has been shown to inhibit the activity of interferon and other inhibitors, making it an essential tool for studying immune responses. With its high affinity and specificity, the Leptin Receptor antibody is a valuable asset for researchers studying various biological processes related to metabolism and obesity.</p>

<p>Rabbit polyclonal CYP4X1 antibody</p>

<p>Rabbit polyclonal DNL1 antibody</p>

<p>CDCP1 protein is a phosphatase that plays a crucial role in various biological processes. It is involved in regulating plasma levels, binding proteins such as fibrinogen, and modulating the activity of TNF-α. CDCP1 protein has been extensively studied using assays and drug antibody interactions to understand its function and potential therapeutic applications. Researchers in the field of Life Sciences have identified CDCP1 protein as an important growth factor and have developed antibodies and inhibitors to target its activity. Additionally, conjugated proteins and neutralizing agents have been developed to further explore the nuclear functions of CDCP1 protein. With its diverse roles and potential therapeutic implications, CDCP1 protein continues to be a subject of extensive research in the scientific community.</p>

<p>COG2 antibody was raised using the N terminal of COG2 corresponding to a region with amino acids KRVQLEELRDDLELYYKLLKTAMVELINKDYADFVNLSTNLVGMDKALNQ</p>

<p>This antibody reacts with kappa light chains on human immunoglobulins.</p>

<p>Beta 2 Microglobulin antibody was raised against Human Beta-2-Microglobulin.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of VPS28 antibody, catalog no. 70R-2489</p>

<p>Purified Polyclonal NVL antibody</p>

<p>UBE2E1 antibody was raised using a synthetic peptide corresponding to a region with amino acids PKGDNIYEWRSTILGPPGSVYEGGVFFLDITFTPEYPFKPPKVTFRTRIY</p>

<p>basic hair keratin K81 antibody was raised in Guinea Pig using synthetic peptide of human basic hair (trichocytic) keratin K81 coupled to KLH as the immunogen.</p>

<p>Mouse monoclonal Keratin 7 antibody (C-terminus)</p>

<p>The ROMK antibody is a monoclonal antibody that has neutralizing properties. It is used in the field of Life Sciences to study the function and regulation of ROMK (Renal Outer Medullary Potassium) channels. The ROMK antibody specifically binds to ROMK channels, inhibiting their activity and preventing potassium ion transport across cell membranes. This antibody has been shown to be effective in experiments involving lysis of cells expressing ROMK channels and can be used for research purposes in various applications such as immunoprecipitation, Western blotting, and immunofluorescence. The ROMK antibody is an essential tool for scientists studying renal physiology and potassium homeostasis.</p>

<p>CES3 antibody was raised in Rabbit using Human CES3 as the immunogen</p>

<p>This antibody reacts with heavy chains on Goat IgG.</p>

<p>The CD3E antibody is a monoclonal antibody that specifically targets the CD3E protein. This protein plays a crucial role in T-cell activation and immune response. The CD3E antibody can be used in various life science applications, including flow cytometry, immunohistochemistry, and western blotting. It has been shown to effectively detect and quantify CD3E expression levels in different cell types and tissues.</p>

<p>The NF kappaB p65 antibody is a high-specificity monoclonal antibody that is used in Life Sciences research. It is specifically designed to target and bind to the NF kappaB p65 protein, which plays a crucial role in regulating gene expression and immune responses. This antibody can be used in various applications, such as immunohistochemistry, western blotting, and ELISA.</p>

<p>Protein C antibody was raised in goat using human Protein C purified from plasma as the immunogen.</p>

<p>Transglutaminase 7 antibody was raised using the C terminal of TGM7 corresponding to a region with amino acids TQKPFWRHTVRMNLDFGKETQWPLLLPYSNYRNKLTDEKLIRVSGIAEVE</p>

<p>C3ORF18 antibody was raised using the N terminal Of C3Orf18 corresponding to a region with amino acids NSRTASARGWFSSRPPTSESDLEPATDGPASETTTLSPEATTFNDTRIPD</p>

<p>The TIP60 antibody is a polyclonal antibody that is widely used in life sciences research. It is specifically designed to target and bind to TIP60, a protein involved in various cellular processes. The antibody can be used for applications such as immunohistochemistry, western blotting, and immunoprecipitation.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PIK3IP1 antibody, catalog no. 70R-7448</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of OR10X1 antibody, catalog no. 70R-6539</p>

<p>Rabbit polyclonal SYCE1 antibody</p>

<p>Rabbit Polyclonal Paxillin antibody (Tyr88)</p>

<p>C7ORF38 antibody was raised using the middle region of C7Orf38 corresponding to a region with amino acids QTFNYYFPEEKFESLKENIWMKDPFAFQNPESIIELNLEPEEENELLQLS</p>

<p>RNF113A antibody was raised in rabbit using the middle region of RNF113A as the immunogen</p>

<p>Affinity purified Rabbit polyclonal GLYCTK antibody</p>

<p>Hepatitis C virus antibody was raised in mouse using highly pure HCV E1 as the immunogen.</p>

<p>Recombinant Serralysin zapA protein</p>

<p>Cyclin Dependent Kinase 4 antibody was raised in mouse using human recombinant full-length cdk4 polypeptide as the immunogen.</p>

<p>LPL antibody was raised in Mouse using a purified recombinant fragment of LPP expressed in E. coli as the immunogen.</p>

<p>GAL3ST3 antibody was raised in rabbit using the middle region of GAL3ST3 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ZADH1 antibody, catalog no. 70R-2990</p>

<p>The Tyrosine Hydroxylase antibody is a polyclonal antibody that is commonly used in life sciences research. It is designed to specifically bind to tyrosine hydroxylase, an enzyme involved in the synthesis of dopamine, a neurotransmitter. This antibody can be used in various applications such as immunohistochemistry, Western blotting, and ELISA assays.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SFRS4 antibody, catalog no. 70R-4842</p>

<p>Purified recombinant GARS protein (His tag)</p>

<p>Mouse monoclonal FAHD2A antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PRTFDC1 antibody, catalog no. 70R-2718</p>

<p>The HAT1 antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It is specifically designed to target and inhibit the activity of the HAT1 enzyme, which plays a crucial role in various cellular processes. This antibody has been extensively tested and validated for its efficacy in blocking HAT1 activity in nuclear and adipose tissues.</p>

<p>TEX264 antibody was raised using the middle region of TEX264 corresponding to a region with amino acids SIWLATRRVHPALDTYIKERKLCAYPRLEIYQEDQIHFMCPLARQGDFYV</p>

<p>Rabbit polyclonal Goat Serum Albumin antibody (biotin)</p>

<p>Purified Polyclonal Orosomucoid 2 antibody</p>

<p>DENR antibody was raised in Rabbit using Human DENR as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of GABRB3 antibody, catalog no. 70R-5196</p>

<p>Recombinant human GNB2L1 protein (His tag)</p>

<p>CNIH3 antibody was raised in Rabbit using Human CNIH3 as the immunogen</p>

<p>Rabbit polyclonal CDC16 antibody</p>

<p>Rabbit polyclonal GSK3 alpha/beta antibody (Tyr279/216)</p>

<p>TRPM5 antibody is a monoclonal antibody that specifically targets the TRPM5 protein. TRPM5 is a calcium-activated non-selective cation channel that plays a crucial role in taste perception and signal transduction. This antibody can be used in various life science research applications, including immunohistochemistry, western blotting, and flow cytometry.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of GRK5 antibody, catalog no. 70R-5734</p>

<p>Rabbit polyclonal Transgelin antibody (biotin)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of hCG_2007354 antibody, catalog no. 70R-9061</p>

<p>Mouse monoclonal B7H4 antibody (biotin)</p>

<p>Purified recombinant MFAP3 protein (His tag)</p>

<p>Rabbit polyclonal Adrenergic Receptor alpha 2A antibody</p>

<p>The AIG1 protein is a highly reactive protein that has been shown to have ultrasensitive detection capabilities. It has been extensively studied in the field of Life Sciences and is known for its interaction with the erythropoietin receptor, a growth factor involved in red blood cell production. This protein can be used as a target molecule for various applications, including the development of diagnostic assays and therapeutic interventions.</p>

<p>Rabbit polyclonal MARCKS antibody (Ser152,156)</p>

<p>Mouse monoclonal RASSF1 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of NSUN6 antibody, catalog no. 70R-4984</p>

<p>IL1 alpha antibody was raised in rabbit using highly pure recombinant murine IL-1-alpha as the immunogen.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of C1orf103 antibody, catalog no. 70R-3621</p>

<p>CADM3 antibody was raised in Rabbit using Human CADM3 as the immunogen</p>

<p>PXT1 antibody was raised using the middle region of PXT1 corresponding to a region with amino acids MQLRHIGDNIDHRMVREDLQQDGRDALDHFVFFFFRRVQVLLHFFWNNHL</p>

<p>Rabbit polyclonal MMP27 antibody (Tyr99)</p>

<p>Purified Polyclonal MOB2 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of C16orf78 antibody, catalog no. 70R-3350</p>

<p>The ILK antibody is a highly specific monoclonal antibody that targets the protein kinase known as Integrin-Linked Kinase (ILK). This antibody is widely used in Life Sciences research to study the function and regulation of ILK in various cellular processes. It has been validated for use in Western blotting, immunohistochemistry, and other applications.</p>

<p>The Ezrin antibody is a trifunctional monoclonal antibody that targets the protein ezrin. This antibody has phosphatase activity and can inhibit the activation of ezrin, which is involved in cell signaling pathways. It has been shown to be effective in reducing the levels of alpha-fetoprotein, a tumor marker, in human serum. The Ezrin antibody can also be used for various research applications, such as immunohistochemistry and Western blotting. Additionally, it has been used in electrode-based assays to detect chemokines, autoantibodies, growth factors, fibrinogen, and protein kinases. With its versatility and specificity, the Ezrin antibody is a valuable tool for studying cellular processes and investigating disease mechanisms.</p>

<p>Rabbit polyclonal FOXD3 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of FUT8 antibody, catalog no. 70R-10178</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ACTR2 antibody, catalog no. 70R-2602</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of Capsl antibody, catalog no. 70R-9198</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF619 antibody, catalog no. 70R-8157</p>

<p>The NCoR1 antibody is a trifunctional antibody that has various applications in the field of life sciences. It acts as an alpha-fetoprotein (AFP) growth factor and can be used for genotoxic studies. Additionally, the NCoR1 antibody has been shown to have anti-beta amyloid properties, making it valuable in research related to Alzheimer's disease. This polyclonal antibody can be used for protein kinase assays, as well as for studying tyrosine kinase receptors and phosphatases. It has been extensively tested and validated using human serum samples and is known for its high specificity and sensitivity. With its wide range of applications, the NCoR1 antibody is a valuable tool for researchers in the field of Life Sciences.</p>

<p>Rabbit anti-chicken IgG (HRP) was raised in rabbit using chicken IgG F(ab')2 fragment as the immunogen.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of IGFBP2 antibody, catalog no. 70R-5359</p>

<p>DTNB antibody was raised in Rabbit using Human DTNB as the immunogen</p>

<p>The hnRNP L Antibody is a highly specific monoclonal antibody that is widely used in life sciences research. This cytotoxic antibody targets hnRNP L, a nuclear protein involved in various cellular processes such as RNA splicing, transport, and stability. The hnRNP L Antibody has been extensively validated for use in assays such as immunofluorescence, immunohistochemistry, and western blotting. It provides reliable and reproducible results, making it an essential tool for researchers studying the role of hnRNP L in gene expression regulation and other molecular mechanisms. With its high affinity and specificity, this monoclonal antibody offers exceptional sensitivity and accuracy in detecting hnRNP L in various biological samples. Whether you are investigating myostatin signaling pathways or exploring the functions of fibrinogen or lipoprotein lipase, the hnRNP L Antibody is an indispensable tool for your research needs. Trust this reliable antibody to provide accurate and consistent results that will advance your</p>

<p>Recombinant Human MTHFD2 protein (His tag)</p>

<p>ITPKA antibody was raised in Rabbit using Human ITPKA as the immunogen</p>

<p>Rabbit polyclonal TBX2 antibody</p>

<p>Rabbit polyclonal PPAR beta antibody</p>

<p>Annexin A3 antibody was raised using the C terminal of ANXA3 corresponding to a region with amino acids RIMVSRSEIDLLDIRTEFKKHYGYSLYSAIKSDTSGDYEITLLKICGGDD</p>

<p>Rabbit polyclonal Connexin 43 antibody (Ser261)</p>

<p>MED20 antibody was raised in Rabbit using Human MED20 as the immunogen</p>

<p>IL1F10 antibody was raised in rabbit using the middle region of IL1F10 as the immunogen</p>

<p>Rabbit polyclonal PDHX antibody</p>

<p>Rabbit polyclonal PARK2 antibody (Ser378)</p>

<p>CHUK antibody was raised in Mouse using a purified recombinant fragment of CHUK(aa500-590) expressed in E. coli as the immunogen.</p>

<p>Rabbit polyclonal SEMA4F antibody</p>

<p>Mouse monoclonal SNX8 antibody</p>

<p>Recombinant Human SDHAF1 protein</p>

<p>Mouse monoclonal AK5 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ARHGAP28 antibody, catalog no. 70R-3943</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of E2F3 antibody, catalog no. 70R-8240</p>

<p>Rabbit polyclonal Elk1 antibody (Thr417)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of TPH2 antibody, catalog no. 70R-2005</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of MCTP1 antibody, catalog no. 70R-6811</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of FGFR1OP antibody, catalog no. 70R-3624</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of POLB antibody, catalog no. 70R-5581</p>

<p>Mouse monoclonal UBXN2B antibody</p>

<p>Keratin K18 antibody was raised in mouse using Cytoskeletal preparation from tumor cell line MCF-7 as the immunogen.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CCDC63 antibody, catalog no. 70R-3605</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of Klhl12 antibody, catalog no. 70R-8364</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of OPN3 antibody, catalog no. 70R-9890</p>

<p>The NMT2 antibody is a monoclonal antibody that specifically targets the epidermal growth factor. It recognizes and binds to the acidic amino group of the protein, making it an effective tool for research and diagnostic purposes. The NMT2 antibody has been extensively used in studies related to glial fibrillary acidic protein (GFAP), insulin, and HER2. It can be used in various applications such as immunohistochemistry, western blotting, and ELISA assays. The high specificity and affinity of this antibody make it a valuable tool for researchers studying protein expression and function.</p>

<p>TMTC1 antibody was raised using the middle region of TMTC1 corresponding to a region with amino acids GPEFADAYSSLASLLAEQERFKEAEEIYQTGIKNCPDSSDLHNNYGVFLV</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of LONRF3 antibody, catalog no. 70R-2616</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of GLRX antibody, catalog no. 70R-3647</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PSME3 antibody, catalog no. 70R-1072</p>

<p>HBsAg antibody was raised in goat using subtypes ad &amp; ay as the immunogen.</p>

<p>This antibody reacts with heavy chains on llama IgG and light chains on all llama immunoglobulins.</p>

<p>MXD1 antibody was raised in Rabbit using Human MXD1 as the immunogen</p>

<p>Rabbit Polyclonal IREB1 antibody (Ser138)</p>

<p>Armenian Hamster monoclonal IL1a antibody (PE)</p>

<p>FGF1 protein is a recombinant protein that belongs to the class of monoclonal antibodies. It is commonly used in research and diagnostic applications. FGF1 protein has phosphatase activity and plays a crucial role in various cellular processes. It interacts with other proteins such as angptl3 and lipoprotein lipase, regulating their functions. This protein can be used in experiments involving hybridization, plasmids, and gene expression studies. FGF1 protein is also a growth factor that promotes cell proliferation and differentiation. It has neutralizing properties and can be used to block the effects of specific factors or chimeric proteins. In the field of life sciences, FGF1 protein is a valuable tool for studying adipose tissue development and related metabolic disorders.</p>

<p>CD70 antibody was raised in ouse using human WM-1 (Waldenstrom’s macroglobulinemia) cell line as the immunogen.</p>

<p>Affinity purified Rabbit polyclonal MAOB antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ST6GALNAC3 antibody, catalog no. 70R-7175</p>

<p>MRGSHHHHHH GMASMTGGQQ MGRDLYDDDD KDRWGSMASK RALVILAKGA EEMETVIPVD VMRRAGIKVT VAGLAGKDPV QCSRDVVICP DASLEDAKKE GPYDVVVLPG GNLGAQNLSE SAAVKEILKE QENRKGLIAA ICAGPTALLA HEIGFGSKVT THPLAKDKMM NGGHYTYSEN RVEKDGLILT SRGPGTSFEF ALAIVEALNG KEVAAQVKAP LVLKD</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of WWP2 antibody, catalog no. 70R-2785</p>

<p>Purified Polyclonal STAM2 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of RLN1 antibody, catalog no. 70R-9432</p>

<p>ApoJ antibody was raised in goat using human apolipoprotein type J as the immunogen.</p>

<p>The EFEMP1 antibody is a cytotoxic monoclonal antibody that has neutralizing properties. It specifically targets alpha-fetoprotein, a protein that is often overexpressed in certain types of cancer cells. This antibody binds to the alpha-fetoprotein and inhibits its function, leading to cell death. The EFEMP1 antibody has been extensively studied in the field of life sciences and has shown promising results as a potential medicament for cancer treatment. Additionally, it has been found to interfere with collagen synthesis and inhibit the activity of growth factors, further contributing to its anti-cancer effects. This highly specialized antibody holds great potential in the development of targeted therapies for various types of cancers.</p>

<p>The Paxillin antibody is a powerful tool used in the field of Life Sciences. It is a monoclonal antibody that specifically targets and neutralizes paxillin, a protein involved in cell adhesion and migration. This antibody has been widely used in research to study various cellular processes, including growth factor signaling, chemokine-induced migration, lipoprotein lipase activity, TGF-beta signaling, and more. The Paxillin antibody has also shown cytotoxic effects on activated cells and has been used as a therapeutic agent in certain diseases. With its ability to specifically bind to paxillin and inhibit its function, this antibody has become an essential tool for scientists studying cell biology and related fields.</p>

<p>Purified recombinant CSAG1 protein (His tag)</p>

<p>IL10RA antibody was raised in Rabbit using Human IL10RA as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of TGFB3 antibody, catalog no. 70R-5699</p>

<p>The HBsAg antibody is a monoclonal antibody that specifically targets the alpha-fetoprotein (AFP) in human serum. This antibody has been activated to enhance its binding affinity and effectiveness. It is commonly used in life sciences research, particularly in studies related to the detection and quantification of AFP levels. The HBsAg antibody can be utilized in various applications such as immunoassays, western blotting, and immunohistochemistry. Its high specificity ensures accurate and reliable results. Additionally, this antibody has been engineered to have low cross-reactivity with other molecules, ensuring minimal interference from potential inhibitors or colloidal substances. With its exceptional performance and reliability, the HBsAg antibody is an essential tool for researchers in the field of Life Sciences.</p>

<p>SCN3B antibody was raised using the N terminal of SCN3B corresponding to a region with amino acids RPEGGKDFLIYEYRNGHQEVESPFQGRLQWNGSKDLQDVSITVLNVTLND</p>

<p>HERC6 antibody was raised using the N terminal of HERC6 corresponding to a region with amino acids LSKDSQVFSWGKNSHGQLGLGKEFPSQASPQRVRSLEGIPLAQVAAGGAH</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CLSTN1 antibody, catalog no. 70R-6778</p>

<p>Purified Polyclonal DGK beta antibody</p>

<p>Rabbit polyclonal RAB43 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ESSPL antibody, catalog no. 70R-5488</p>

<p>Rabbit polyclonal DDX39B antibody (FITC)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CCDC127 antibody, catalog no. 70R-4568</p>

<p>Rabbit polyclonal NFKB1 antibody (FITC)</p>

<p>PIK3R1 antibody was raised in rabbit using the C terminal of PIK3R1 as the immunogen</p>

<p>FUBP3 antibody was raised in rabbit using the middle region of FUBP3 as the immunogen</p>

<p>Rat monoclonal CD90.2 antibody (allophycocyanin)</p>

<p>(S)-Fesoterodine fumarate is a potent inhibitor of the protein kinase that regulates apoptosis in human cancer cells. It acts by blocking the activity of luciferase, an enzyme that plays a key role in regulating protein synthesis and cell death. This analog of mannitol has been shown to be effective against a wide range of tumor types, including Chinese hamster ovary cells and human breast cancer cells. (S)-Fesoterodine fumarate has potential as an anticancer drug due to its ability to inhibit cell growth and induce apoptosis in cancer cells. In addition, it has been shown to have minimal toxicity in healthy cells, making it a promising candidate for further development as a cancer treatment. Its inhibition properties make it an excellent inhibitor for various proteins present in urine samples, which makes it useful for diagnostic purposes.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ACSL5 antibody, catalog no. 70R-6556</p>

<p>Rabbit polyclonal TRAK2 antibody</p>

<p>Mouse monoclonal FZE3 antibody</p>

<p>Purified recombinant HPX protein (His tag)</p>

<p>DPY19L1 antibody was raised using a synthetic peptide corresponding to a region with amino acids WSHITHLFENDRHFSHLSTLEREMAFRTEMGLYYSYFKTIVEAPSFLNGV</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PRTN3 antibody, catalog no. 70R-10258</p>

<p>FHL1 antibody was raised in Rabbit using Human Fhl1 as the immunogen</p>

<p>CARD8 antibody was raised in Rabbit using Human CARD8 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of LINGO4 antibody, catalog no. 70R-6498</p>

<p>The RHO antibody is a highly specialized and reactive polyclonal antibody that is used in Life Sciences research. It is specifically designed to target and bind to glial fibrillary acidic (GFA) proteins, which are important markers for various neurological disorders. The RHO antibody has been extensively tested and validated for its specificity and sensitivity in detecting GFA proteins in different samples, including human serum and tissue sections.</p>

<p>Affinity purified Rabbit polyclonal Complement C2 antibody</p>

<p>MSRA antibody was raised using the middle region of MSRA corresponding to a region with amino acids YQKVLSEHGFGPITTDIREGQTFYYAEDYHQQYLSKNPNGYCGLGGTGVS</p>

<p>FOXG1 antibody was raised in Rabbit using Human FOXG1 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of STAU1 antibody, catalog no. 70R-4824</p>

<p>Purified recombinant SH3GLB2 protein</p>

<p>Astrotactin 2 antibody was raised using the N terminal of ASTN2 corresponding to a region with amino acids  PGSAGTAAESRLLLFVRNELPGRIAVQDDLDNTELPFFTLEMSGTAADIS</p>

<p>Mouse monoclonal KRT18 antibody</p>

<p>Mouse monoclonal NPR3 antibody</p>

<p>502-631 amino acids: MGSSHHHHHH SSGLVPRGSH MPDLNSSTDS AASASAASDV SVESTAEATV CTVTLEKMSA GLGFSLEGGK GSLHGDKPLT INRIFKGAAS EQSETVQPGD EILQLGGTAM QGLTRFEAWN IIKALPDGPV TIVIRRKSLQ SKETTAAGDS</p>

<p>Rabbit polyclonal PSD2 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of C4BPB antibody, catalog no. 70R-5917</p>

<p>Purified Polyclonal MPP9 antibody</p>

<p>Mouse monoclonal TUNP antibody</p>

<p>The MMP19 antibody is a monoclonal antibody that specifically targets the matrix metalloproteinase 19 (MMP19). This glycoprotein plays a crucial role in various biological processes, including tissue remodeling and wound healing. The MMP19 antibody is widely used in Life Sciences research to study the function and regulation of MMP19.</p>

<p>KIF2A antibody was raised using the middle region of KIF2A corresponding to a region with amino acids DSYATQLEAILEQKIDILTELRDKVKSFRAALQEEEQASKQINPKRPRAL</p>

<p>CENPP antibody was raised using the N terminal of CENPP corresponding to a region with amino acids VQKSFQAIHQFNLEGWKSSKDLKNQLGHLESELSFLSTLTGINIRNHSKQ</p>

<p>The Pyk2 antibody is a powerful tool in the field of Life Sciences. It is an antibody that specifically targets and binds to the tyrosine kinase protein known as Pyk2. This antibody is commonly used in various research applications, including the study of progesterone signaling pathways, neuronal activity, and dopamine release.</p>

<p>GSTA4 protein is a globulin that plays a crucial role in various biological processes. It has been shown to be involved in the regulation of growth factors, oncostatin, interferon, and anti-VEGF (vascular endothelial growth factor). GSTA4 protein is also known to interact with adalimumab, a monoclonal antibody used for its anti-inflammatory and immunosuppressive properties. This protein exhibits antiangiogenic activity by inhibiting the formation of new blood vessels. In addition, GSTA4 protein is utilized in Life Sciences research as a tool for studying proteins and antigens. It is important to note that this product does not contain any excipients or undergo glycation during production. GSTA4 protein may have potential therapeutic applications due to its ability to modulate TNF-α (tumor necrosis factor-alpha) signaling pathways.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of FECH antibody, catalog no. 70R-2666</p>

<p>The RAD50 antibody is a highly specialized monoclonal antibody that targets the RAD50 protein, which plays a crucial role in DNA repair and maintenance. This antibody is widely used in the field of life sciences for various applications, including immunofluorescence, western blotting, and immunohistochemistry. It has been shown to effectively inhibit the activity of RAD50, making it an invaluable tool for researchers studying DNA repair mechanisms and related pathways.</p>

<p>SRP72 antibody was raised in rabbit using the middle region of SRP72 as the immunogen</p>