Biochemicals and Reagents

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of XRCC2 antibody, catalog no. 70R-5542</p>

<p>PINX1 antibody was raised in rabbit using the middle region of PINX1 as the immunogen</p>

<p>Affinity purified Rabbit polyclonal Hsp22 antibody</p>

<p>ALDH18A1 antibody was raised in Rabbit using Human ALDH18A1 as the immunogen</p>

<p>Purified Polyclonal Frizzled 8 antibody</p>

<p>PSMC4 antibody was raised using a synthetic peptide corresponding to a region with amino acids MEEIGILVEKAQDEIPALSVSRPQTGLSFLGPEPEDLEDLYSRYKKLQQE</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of TMEM146 antibody, catalog no. 70R-7054</p>

<p>The CDH17 antibody is a phosphatase that belongs to the family of monoclonal antibodies. It has neutralizing properties and is commonly used in Life Sciences research. This antibody specifically targets the growth factor colloidal and tyrosine antigen, which are important for various cellular processes. Additionally, it has been shown to bind to the circumsporozoite protein, glucagon, and neurotrophic acidic antibodies. The CDH17 antibody is a valuable tool for studying these proteins and their functions in different biological systems.</p>

<p>DNASE1L1 antibody was raised in Rabbit using Human DNASE1L1 as the immunogen</p>

<p>Rabbit polyclonal PTPN18 antibody</p>

<p>Rabbit polyclonal PDI antibody (FITC)</p>

<p>P2RXL1 antibody was raised using the N terminal of P2RXL1 corresponding to a region with amino acids NWRVGALQRLLQFGIVVYVVGWALLAKKGYQERDLEPQFSIITKLKGVSV</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of EIF3E antibody, catalog no. 70R-3591</p>

<p>DAG1 antibody was raised in Rabbit using Human DAG1 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of DDX17 antibody, catalog no. 70R-5026</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PDK3 antibody, catalog no. 70R-2460</p>

<p>CCDC70 antibody was raised using the middle region of CCDC70 corresponding to a region with amino acids TFRGKIHAFRGQILGFWEEERPFWEEEKTFWKEEKSFWEMEKSFREEEKT</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SLC38A1 antibody, catalog no. 70R-1755</p>

<p>ZNF708 antibody was raised in rabbit using the N terminal of ZNF708 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PM20D2 antibody, catalog no. 70R-4116</p>

<p>Rabbit polyclonal CNTF antibody (HRP)</p>

<p>The HSP40 antibody is a highly specialized product used in Life Sciences research. It is designed to target and bind to specific proteins known as heat shock proteins (HSPs) in human serum. These antibodies have been extensively studied and proven effective in various applications, including nuclear receptor studies, insulin signaling pathways, and caspase-9 activation.</p>

<p>Fibrinogen antibody was raised in sheep using human Fibrinogen purified from plasma as the immunogen.</p>

<p>The OR51E2 antibody is a highly specialized monoclonal antibody that is used in various Life Sciences applications. This antibody specifically targets and interacts with the OR51E2 protein, which plays a crucial role in cellular processes such as cell growth, proliferation, and differentiation.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CMTM2 antibody, catalog no. 70R-6338</p>

<p>Rabbit polyclonal NFKP p65 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CSNK1G1 antibody, catalog no. 20R-1168</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of NT5DC2 antibody, catalog no. 70R-4565</p>

<p>ELF1 antibody was raised in Rabbit using Human ELF1 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ERAL1 antibody, catalog no. 70R-4906</p>

<p>WFDC1 antibody was raised using the middle region of WFDC1 corresponding to a region with amino acids VAEGIPNRGQCVKQRRQADGRILRHKLYKEYPEGDSKNVAEPGRGQQKHF</p>

<p>Rabbit polyclonal TSG6 antibody</p>

<p>CDC73 antibody was raised in Rabbit using Human CDC73 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PABPC4 antibody, catalog no. 70R-4874</p>

<p>SERAC1 antibody was raised in rabbit using the N terminal of SERAC1 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of GADD45B antibody, catalog no. 70R-5930</p>

<p>The iNOS antibody is a neuroprotective monoclonal antibody that targets inducible nitric oxide synthase (iNOS). It is commonly used in Life Sciences research and has shown promising results in various studies. This antibody specifically binds to iNOS, inhibiting its activity and preventing the production of nitric oxide. Nitric oxide is a signaling molecule that plays a role in various physiological processes, including inflammation and neuronal signaling. By blocking iNOS, the antibody can help reduce inflammation and protect neurons from damage.</p>

<p>Purified recombinant Human IFN alpha I protein</p>

<p>ADRBK2 antibody was raised in Rabbit using Human ADRBK2 as the immunogen</p>

<p>ACBD3 antibody was raised using the N terminal of ACBD3 corresponding to a region with amino acids EARRLEQRWGFGLEELYGLALRFFKEKDGKAFHPTYEEKLKLVALHKQVL</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SLC23A2 antibody, catalog no. 70R-6281</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the category of rifamycins. It is known to effectively treat tuberculosis infections by targeting active compounds and exhibiting bactericidal activity. Through its binding to DNA-dependent RNA polymerase, this drug inhibits bacterial growth, preventing transcription and replication. Its efficacy has been demonstrated through patch-clamp technique studies on human erythrocytes. The drug undergoes various metabolic transformations, including hydrolysis, oxidation, reduction, and conjugation with glucuronic acid. Additionally, it specifically binds to markers expressed in Mycobacterium tuberculosis strains, inhibiting their growth in culture.</p>

<p>SLC25A29 antibody was raised using the C terminal of SLC25A29 corresponding to a region with amino acids AEGWRVFTRGLASTLLRAFPVNAATFATVTVVLTYARGEEAGPEGEAVPA</p>

<p>hCG_20426 antibody was raised in rabbit using the C terminal of HCG_20426 as the immunogen</p>

<p>DLEU1 antibody was raised in Rabbit using Human DLEU1 as the immunogen</p>

<p>Mouse anti-25OH Vitamin D2/D3 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of DGAT2L3 antibody, catalog no. 70R-6781</p>

<p>Purified recombinant Human KAAG1 protein</p>

<p>TYRO3 antibody was raised in Mouse using purified recombinant extracellular fragment of human TYRO3 fused with hIgGFc tag expressed in HEK293 cell line as the immunogen.</p>

<p>ACLY antibody was raised in Rabbit using Human ACLY as the immunogen</p>

<p>SPIRE2 antibody was raised in rabbit using the N terminal of SPIRE2 as the immunogen</p>

<p>DNAJC16 antibody was raised in Rabbit using Human DNAJC16 as the immunogen</p>

<p>The RAD51 antibody is a polyclonal antibody widely used in the field of Life Sciences. It specifically targets RAD51, a protein involved in DNA repair and recombination. This antibody has been extensively studied and proven to be highly effective in various applications, including Western blotting, immunohistochemistry, and immunofluorescence.</p>

<p>Purified Polyclonal COASY antibody</p>

<p>FDFT1 antibody was raised using the N terminal of FDFT1 corresponding to a region with amino acids HSFLYQPDWRFMESKEKDRQVLEDFPTISLEFRNLAEKYQTVIADICRRM</p>

<p>Rabbit polyclonal GSK3 beta antibody</p>

<p>PSG3 antibody was raised using the N terminal of PSG3 corresponding to a region with amino acids VYSNASLLIQNVTREDAGSYTLHIVKRGDGTRGETGHFTFTLYLETPKPS</p>

<p>Factor IX antibody (HRP) was raised in goat using human Factor IX purified from plasma as the immunogen.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of MPST antibody, catalog no. 70R-2488</p>

<p>PCI antibody was raised in goat using human Protein C Inhibitor purified from plasma as the immunogen.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of MSRA antibody, catalog no. 70R-3994</p>

<p>AGXT2L2 antibody was raised in Rabbit using Human AGXT2L2 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of FAM83E antibody, catalog no. 70R-3875</p>

<p>The Contactin 2 antibody is a powerful tool used in the field of Life Sciences. It is a monoclonal antibody that specifically targets Contactin 2, a protein involved in cell adhesion and neuronal development. This antibody has been extensively studied for its potential therapeutic applications in various diseases, including autoimmune disorders and cancer.</p>

<p>Purified recombinant Human GSKIP protein</p>

<p>CD9 antibody was raised in mouse using human CD9 as the immunogen.</p>

<p>Rabbit polyclonal CCKAR antibody</p>

<p>INTS12 antibody was raised in rabbit using the N terminal of INTS12 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SIN3B antibody, catalog no. 70R-8939</p>

<p>EIF2A antibody was raised in Rabbit using Human EIF2A as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SUMO3 antibody, catalog no. 70R-3146</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of HOM-TES-103 antibody, catalog no. 70R-9325</p>

<p>C14ORF130 antibody was raised using the C terminal Of C14Orf130 corresponding to a region with amino acids DRSDPLMDTLSSMNRVQQVELICEYNDLKTELKDYLKRFADEGTVVKRED</p>

<p>FAM26A antibody was raised using the C terminal Of Fam26A corresponding to a region with amino acids RSELQARGLRRGNAGRRLELPAVPEPPEGLDSGSGKAHLRAISSREQVDR</p>

<p>The RAD51 antibody is a highly specialized monoclonal antibody that is used in Life Sciences research. It specifically targets the RAD51 protein, which plays a crucial role in DNA repair and recombination. This antibody has been extensively tested and validated for use in various applications, including Western blotting, immunoprecipitation, and immunofluorescence.</p>

<p>Rabbit polyclonal GABRA1 antibody (N-Terminus)</p>

<p>RPL9 antibody was raised using the C terminal of RPL9 corresponding to a region with amino acids ELILEGNDIELVSNSAALIQQATTVKNKDIRKFLDGIYVSEKGTVQQADE</p>

<p>Rabbit polyclonal Encephalopsin antibody</p>

<p>Rabbit polyclonal PROM1 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of FBXW2 antibody, catalog no. 70R-2786</p>

<p>The PRKACB antibody is a highly specific antibody that targets the protein kinase A catalytic subunit beta (PRKACB). This antibody is derived from a vaccine strain and has been extensively tested for its antigen specificity. It has shown high affinity and selectivity for PRKACB, making it an ideal tool for studying the function and regulation of this protein.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of GCH1 antibody, catalog no. 70R-9829</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of RNF6 antibody, catalog no. 70R-2741</p>

<p>The STAT1 antibody is a highly specialized monoclonal antibody that specifically targets and binds to the activated form of STAT1 protein. This antibody has been widely used in life sciences research to study various cellular processes and signaling pathways involving STAT1.</p>

<p>Recombinant human UNC119B protein (His tag)</p>

<p>Rabbit polyclonal RPS9 antibody (FITC)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SSTR1 antibody, catalog no. 70R-9812</p>

<p>Rabbit polyclonal ATF5 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of MAP4K2 antibody, catalog no. 70R-5784</p>

<p>TGFB3 protein is a growth factor that plays a crucial role in various biological processes. It is involved in the regulation of cell proliferation, differentiation, and apoptosis. TGFB3 protein has been shown to have cytotoxic effects on cancer cells and can inhibit their growth. It also plays a role in wound healing by promoting collagen synthesis. Additionally, TGFB3 protein is known to regulate the expression of lipoprotein lipase, which is involved in lipid metabolism. This protein can be used as a medicament for the treatment of certain diseases and disorders. Its therapeutic potential extends to conditions such as inflammation, autoimmune diseases, and neurodegenerative disorders. TGFB3 protein has also been found to interact with other molecules such as chemokines and annexins, further highlighting its importance in cellular signaling pathways. With its diverse functions and interactions, TGFB3 protein is a valuable tool for researchers in the field of life sciences studying various biological processes and developing new therapeutic strategies.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SPAG8 antibody, catalog no. 70R-2386</p>

<p>MLDP antibody was raised in Guinea Pig using synthetic peptide C-terminal aa 451-463 of human MLDP as the immunogen.</p>

<p>The Elk1 antibody is a highly specialized polyclonal antibody used in Life Sciences research. It is designed to specifically target and bind to the Elk1 protein, which plays a crucial role in gene expression regulation. The Elk1 antibody can be used for various applications such as immunohistochemistry, western blotting, and ELISA.</p>

<p>Affinity purified Rabbit polyclonal KHS antibody</p>

<p>Neisseria Gonorrhoeae Antibody is a growth factor that targets the annexin A2 protein. This monoclonal antibody has been developed to specifically bind to Neisseria gonorrhoeae, a bacteria responsible for causing the sexually transmitted infection gonorrhea. By targeting and binding to specific proteins on the surface of the bacteria, this antibody helps in neutralizing and eliminating the pathogen from the body. Additionally, this antibody has shown potential in inhibiting the attachment of N. gonorrhoeae to host cells, preventing its entry and subsequent infection.</p>

<p>Legionella pneumophila Monoclonal Antibody</p>

<p>Rabbit Polyclonal CDC2 antibody (Tyr15)</p>

<p>The HDAC4 antibody is a highly specific monoclonal antibody that is used for the treatment and/or prophylaxis of various diseases. It is commonly used in immunoassays and research studies in the field of Life Sciences. This antibody can be immobilized on an electrode or coupled with streptavidin for quantitation purposes. The HDAC4 antibody has been shown to have anti-angiogenic properties, making it a potential therapeutic option for diseases characterized by abnormal blood vessel growth. Its high specificity and affinity make it an ideal tool for the detection and analysis of HDAC4 in human serum samples. Additionally, this antibody can be used as an inhibitor to study the role of HDAC4 in various cellular processes, such as gene expression and protein regulation. With its wide range of applications, the HDAC4 antibody is a valuable tool for researchers in both academia and industry.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of TKT antibody, catalog no. 70R-2587</p>

<p>ETS2 antibody was raised in Rabbit using Human ETS2 as the immunogen</p>

<p>CCNDBP1 antibody was raised in rabbit using the middle region of CCNDBP1 as the immunogen</p>

<p>Purified recombinant Human THTPA protein</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CCNB3 antibody, catalog no. 70R-8395</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of OMG antibody, catalog no. 70R-6385</p>

<p>Aadacl1 antibody was raised in rabbit using the middle region of Aadacl1 as the immunogen</p>

<p>The HER2 antibody is a highly specialized antibody used in the field of Life Sciences. It can be either a polyclonal or monoclonal antibody, designed to target the HER2 protein molecule. This protein is found on the surface of certain cancer cells and is associated with aggressive tumor growth.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CUGBP2 antibody, catalog no. 70R-4819</p>

<p>Rabbit polyclonal IFNGR antibody (Tyr457)</p>

<p>ACOT12 antibody was raised using the middle region of ACOT12 corresponding to a region with amino acids SASRLCWAHPFLKSVDMFKFRGPSTVGDRLVFTAIVNNTFQTCVEVGVRV</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of RGS13 antibody, catalog no. 70R-1144</p>

<p>alpha Actinin 3 antibody was raised using the N terminal of ACTN3 corresponding to a region with amino acids  VQNFHTSWKDGLALCALIHRHRPDLIDYAKLRKDDPIGNLNTAFEVAEKY</p>

<p>CD11a antibody was raised in mouse using human CD11a (LFA-1a) as the immunogen.</p>

<p>The CD42c antibody is a potent inhibitor that targets the platelet membrane. It acts as a metastasis inhibitor by preventing the attachment of cancer cells to platelets, thereby inhibiting their spread to other parts of the body. The CD42c antibody can be used in various applications, including in vitro experiments and life sciences research. It is commonly used in immunosorbent assays and can also be conjugated to liposomes or protein microparticles for targeted drug delivery. This polyclonal antibody specifically recognizes and binds to activated CD42c glycoprotein on platelets, providing a reliable tool for studying platelet function and related disorders. With its high specificity and efficacy, the CD42c antibody is an essential component for researchers and scientists working in the field of platelet biology and metastasis inhibition.</p>

<p>Mouse monoclonal HBsAg antibody (Gold Colloid)</p>

<p>Tmem33 antibody was raised in rabbit using the middle region of Tmem33 as the immunogen</p>

<p>SARS antibody was raised using the middle region of SARS corresponding to a region with amino acids SQFDEELYKVIGKGSEKSDDNSYDEKYLIATSEQPIAALHRDEWLRPEDL</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections due to its potent bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, preventing transcription and replication, thereby inhibiting bacterial growth. Extensive studies have demonstrated its efficacy using advanced techniques like transcription-quantitative polymerase chain and patch-clamp technique. The active form of this drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome p450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets Mycobacterium tuberculosis strains and inhibits their cell growth in culture.</p>

<p>ARVCF Oxidase antibody was raised in Guinea Pig using Two synthetic peptides of human ARVCF as the immunogen.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of FLYWCH1 antibody, catalog no. 70R-10075</p>

<p>Rabbit polyclonal VOPP1 antibody (biotin)</p>

<p>Rabbit polyclonal AFX antibody</p>

<p>COX8A antibody was raised in Rabbit using Human COX8A as the immunogen</p>

<p>The EGFR antibody is a cytotoxic monoclonal antibody that targets the epidermal growth factor receptor (EGFR). It is used as a diagnostic reagent in the field of life sciences to detect and measure the levels of EGFR protein biomarkers. This antibody specifically recognizes and binds to EGFR, inhibiting its activation and downstream signaling pathways. By blocking the interaction between EGFR and its ligands, such as epidermal growth factor, the antibody effectively inhibits cell proliferation and survival. The EGFR antibody has been extensively studied for its potential therapeutic applications in cancer treatment, particularly in tumors that overexpress EGFR. Additionally, this antibody has shown promising results in preclinical studies as a potential nephrotoxic agent due to its ability to inhibit hydroxylase activity. Overall, the EGFR antibody is a valuable tool for researchers and clinicians in studying and targeting EGFR-related diseases.</p>

<p>Purified Rabbit polyclonal ITGB1 antibody (Tyr795)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of H1FOO antibody, catalog no. 70R-2024</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of GBA3 antibody, catalog no. 70R-9508</p>

<p>MAT1A antibody was raised using the C terminal of MAT1A corresponding to a region with amino acids VAKSLVKAGLCRRVLVQVSYAIGVAEPLSISIFTYGTSQKTERELLDVVH</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of APOBEC2 antibody, catalog no. 70R-1425</p>

<p>BCHE antibody was raised using the N terminal of BCHE corresponding to a region with amino acids SSLHVYDGKFLARVERVIVVSMNYRVGALGFLALPGNPEAPGNMGLFDQQ</p>

<p>This antibody reacts with heavy chains on Goat IgG and light chains on all Goat immunoglobulins.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of KRT20 antibody, catalog no. 70R-1189</p>

<p>Rabbit polyclonal Breast Tumor Kinase antibody</p>

<p>The Ku70 antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It targets and inhibits the activity of hepatocyte growth factor, a key growth factor involved in various cellular processes. This antibody can be used for research purposes to study the role of hepatocyte growth factor in different biological systems.</p>

<p>Rabbit polyclonal PSME2 antibody (HRP)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of GZMK antibody, catalog no. 70R-7203</p>

<p>The Tau antibody is a highly specialized Polyclonal Antibody that targets the annexin protein. It is commonly used in Life Sciences research for its ability to inhibit the activity of oncostatin and anti-cd33 antibodies. This monoclonal antibody offers a powerful tool for researchers studying the role of annexin in various cellular processes.</p>

<p>The p53 antibody is a highly sought-after product in the field of Life Sciences. It is an antibody that specifically targets and binds to the p53 protein, which plays a crucial role in regulating cell growth and preventing tumor formation. This monoclonal antibody has been extensively tested and validated for its specificity and sensitivity in detecting p53 protein expression in human serum samples.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SRA1 antibody, catalog no. 70R-10353</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SIGLEC7 antibody, catalog no. 70R-6142</p>

<p>Cytokeratin 18 protein is a vital component of the cytoskeleton in epithelial cells. It is commonly used as a biomarker for the detection and diagnosis of various types of cancers, including breast, lung, and liver cancer. Monoclonal antibodies specific to cytokeratin 18 protein are widely used in research and diagnostic assays to detect its presence in tissues or body fluids. These antibodies can be used in immunohistochemistry, western blotting, or ELISA assays to accurately quantify cytokeratin 18 protein levels.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of UBE2D2 antibody, catalog no. 70R-1828</p>

<p>Rabbit polyclonal OR5H1 antibody</p>

<p>Rabbit polyclonal TPMT antibody</p>

<p>The PIK3R3 antibody is a powerful tool in the field of biomedical research. It specifically targets lyso-gb1, an antigen that plays a crucial role in various cellular processes. This polyclonal antibody can be used to detect and study the expression of lyso-gb1 in different tissues and cell types.</p>

<p>Rabbit polyclonal ZNF436 antibody</p>

<p>MMP16 antibody was raised using a synthetic peptide corresponding to a region with amino acids ALAAMQQFYGINMTGKVDRNTIDWMKKPRCGVPDQTRGSSKFHIRRKRYA</p>

<p>Rabbit polyclonal PKC theta antibody (Thr505)</p>

<p>Rabbit polyclonal CXCL5 antibody (biotin)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of INSR antibody, catalog no. 70R-10509</p>

<p>Rabbit polyclonal Rab1A antibody (FITC)</p>

<p>The Myc Tag antibody is a highly reactive antibody that is commonly used in Life Sciences research. It specifically targets the Myc epitope, which is a small protein tag often fused to target proteins for detection and purification purposes. This antibody has been extensively validated and shown to have high affinity and specificity for the Myc tag.</p>

<p>Purified recombinant Human PNP protein</p>

<p>Rabbit polyclonal ABL1 antibody (biotin)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of LAP3 antibody, catalog no. 70R-2902</p>

<p>Affinity purified Rabbit polyclonal AKAP10 antibody</p>

<p>DHRS2 antibody was raised using a synthetic peptide corresponding to a region with amino acids LEHCGGVDFLVCSAGVNPLVGSTLGTSEQIWDKILSVNVKSPALLLSQLL</p>

<p>Affinity purified Rabbit polyclonal HMBOX1 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of TROVE2 antibody, catalog no. 70R-1372</p>

<p>The p53 antibody is a neutralizing monoclonal antibody that targets the influenza hemagglutinin protein. It is commonly used in Life Sciences research to study the effects of various growth factors and drugs, such as pioglitazone, on cellular processes. The p53 antibody is produced by hybridoma cells and has been shown to specifically bind to p53 protein expressed in human hepatocytes and other cell types. This antibody can be used for applications such as immunofluorescence, immunohistochemistry, and Western blotting to detect and quantify the levels of p53 protein in various samples. Its high specificity and affinity make it a valuable tool for researchers studying cell signaling pathways, cancer biology, and other related fields.</p>

<p>XAB2 antibody was raised in rabbit using the N terminal of XAB2 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of MAGED2 antibody, catalog no. 70R-9922</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections, as it contains active compounds with bactericidal activity. By binding to DNA-dependent RNA polymerase, this drug inhibits bacterial growth, preventing transcription and replication. Its potency has been demonstrated through the use of a patch-clamp technique on human erythrocytes. The drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits their cell growth in culture.</p>

<p>CRCP antibody was raised in Rabbit using Human CRCP as the immunogen</p>

<p>The PCBP2 antibody is a polyclonal antibody that specifically targets the PCBP2 protein. This protein plays a crucial role in various biological processes, including regulation of insulin production and growth factor signaling. The PCBP2 antibody is widely used in life sciences research to study the function and expression of PCBP2.</p>

<p>Pigw antibody was raised in rabbit using the middle region of Pigw as the immunogen</p>

<p>NUP155 antibody was raised using the middle region of NUP155 corresponding to a region with amino acids ISLHLQDICPLLYSTDDAICSKANELLQRSRQVQNKTEKERMLRESLKEY</p>

<p>Rabbit polyclonal CGK2 antibody</p>

<p>Purified recombinant Human BCL7A protein (His tag)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PRSS16 antibody, catalog no. 70R-6967</p>

<p>AHR antibody was raised in Rabbit using Human AHR as the immunogen</p>

<p>Enterovirus antibody is a biomolecule that specifically targets the glycoprotein of enteroviruses. It is a monoclonal antibody that has been shown to have neutralizing properties against enteroviruses, preventing their ability to infect host cells. This antibody is widely used in Life Sciences research to study the mechanisms of enterovirus infection and develop potential antiviral therapies. Additionally, Enterovirus antibody can be used in diagnostic assays to detect the presence of enteroviruses in patient samples. Its high specificity and sensitivity make it a valuable tool for detecting and studying these viral infections.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of NDRG1 antibody, catalog no. 70R-1123</p>

<p>MDR1 antibody is a chemokine that belongs to the group of polyclonal antibodies. It targets the MDR1 protein, also known as P-glycoprotein, which plays a crucial role in multidrug resistance in cancer cells. The MDR1 antibody can be used for various applications, including telomerase detection, microsphere-based immunoassays, and helicobacter pylori diagnosis. It can also be used to detect autoantibodies and colloidal gold-labeled antibodies. Additionally, the MDR1 antibody has been shown to have anti-connexin agent activity and can inhibit annexin binding. It can be used as a substrate for siRNA delivery or as a monoclonal antibody for macrophage inflammatory response studies. The MDR1 antibody is an essential tool for researchers studying phosphorylcholine antigens and their interactions with immune cells.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SLCO6A1 antibody, catalog no. 70R-1799</p>

<p>Rad21 antibody was raised in rabbit using the C terminal of Rad21 as the immunogen</p>

<p>Goat anti-human IgG (H+L) (Fab'2) was raised in goat using human IgG whole molecule as the immunogen.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of MDP-1 antibody, catalog no. 70R-3521</p>

<p>Rabbit Polyclonal Keratin 8 antibody (Ser74)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CRBN antibody, catalog no. 70R-3211</p>

<p>Goat anti-Guinea Pig IgG (H + L) (Alk Phos) was raised in goat using purified Guinea Pig IgG (H&amp;L) as the immunogen.</p>

<p>1-191 amino acids: MGKQNSKLAP EVMEDLVKST EFNEHELKQW YKGFLKDCPS GRLNLEEFQQ LYVKFFPYGD ASKFAQHAFR TFDKNGDGTI DFREFICALS ITSRGSFEQK LNWAFNMYDL DGDGKITRVE MLEIIEAIYK MVGTVIMMKM NEDGLTPEQR VDKIFSKMDK NKDDQITLDE FKEAAKSDPS IVLLLQCDIQ K</p>