Biochemicals and Reagents

<p>The PML antibody is a monoclonal antibody that specifically targets the protein known as promyelocytic leukemia (PML). It has been extensively studied in the field of Life Sciences and is widely used in research and diagnostic applications. The PML antibody binds to PML, inhibiting its activity and preventing its interaction with other proteins. This antibody has been shown to have neutralizing effects on PML function, making it a valuable tool for studying the role of PML in various cellular processes. Additionally, the PML antibody has been conjugated with different tags such as fluorescein isothiocyanate (FITC) or horseradish peroxidase (HRP), allowing for easy detection and visualization of PML in cells and tissues. With its high specificity and affinity, the PML antibody provides researchers with a reliable tool for investigating the function of PML and its potential involvement in disease processes.</p>

<p>Purified recombinant BSND protein (His tag)</p>

<p>NFATc2 antibody was raised in rabbit using residues 269-281 [ASPQRSRSPSPQP] of the human NFATc2 protein as the immunogen.</p>

<p>The Ferritin light chain antibody is a monoclonal antibody that targets the ferritin light chain protein. This antibody has been shown to have various characteristics and functions, including its ability to modulate vasoactive intestinal peptide (VIP) and growth factor signaling pathways. Additionally, it has been found to interact with dopamine and regulate copper concentrations in cells.</p>

<p>The LCK antibody is a highly specialized antibody used in Life Sciences research. It belongs to the group of Monoclonal Antibodies and is known for its cytotoxic and neutralizing properties. The LCK antibody specifically targets β-catenin, a protein involved in cell adhesion and signaling pathways.</p>

<p>Mouse monoclonal NHEJ1 antibody</p>

<p>Norbuprenorphine 3 Conjugate for use in immunoassays</p>

<p>Rabbit Polyclonal KRCC1 antibody</p>

<p>HIV1 gp41 antibody was raised in goat using recombinant ectodomain of gp41 as the immunogen.</p>

<p>TSH antibody was raised in mouse using huma pituitary TSH as the immunogen.</p>

<p>Purified native Human Lactate Dehydrogenase 2 protein</p>

<p>Mouse monoclonal LDLRAP1 antibody</p>

<p>Purified Polyclonal LSM2 antibody</p>

<p>Purified Rabbit polyclonal ETNK1 antibody</p>

<p>The ATF2 antibody is a highly specialized antibody that is used in Life Sciences research. It is an inhibitor of the epidermal growth factor and acts as a cytotoxic agent against specific cells. This monoclonal antibody specifically targets ATF2, a transcription factor involved in cell growth and development. The ATF2 antibody can be used for various applications, including Western blotting, immunohistochemistry, and flow cytometry. It is available as both a recombinant antigen and as polyclonal antibodies. The neutralizing properties of this antibody make it an essential tool for studying the role of ATF2 in cellular processes. With its high specificity and affinity to the target protein, the ATF2 antibody provides accurate and reliable results in research experiments.</p>

<p>KIFC3 antibody was raised using the C terminal of KIFC3 corresponding to a region with amino acids EHLEWEPACQTPQPSARAHSAPSSGTSSRPGSIRRKLQPSGKSRPLPV</p>

<p>TMEM126B antibody was raised using the N terminal of TMEM126B corresponding to a region with amino acids AASMHGQPSPSLEDAKLRRPMVIEIIEKNFDYLRKEMTQNIYQMATFGTT</p>

<p>Rabbit polyclonal OR5B12 antibody</p>

<p>Mouse monoclonal ATP5B antibody</p>

<p>Rabbit polyclonal CaMK1A antibody (Thr177)</p>

<p>SLC5A4 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>Rabbit polyclonal SERINC3 antibody</p>

<p>ULBP1 antibody was raised using the N terminal of ULBP1 corresponding to a region with amino acids MAAAASPAFLLCLPLLHLLSGWSRAGWVDTHCLCYDFIITPKSRPEPQWC</p>

<p>The Histone H3 antibody is a monoclonal antibody that specifically targets histone H3, a protein involved in the packaging of DNA into chromatin. This antibody is commonly used in research studies to investigate histone modifications and their impact on gene expression. It is particularly useful for techniques such as chromatin immunoprecipitation assay (ChIP) which allows researchers to study the interactions between proteins and DNA. The Histone H3 antibody has been extensively validated and is known for its high specificity and sensitivity. It has been successfully used in various applications including Western blotting, immunofluorescence, and immunohistochemistry. Researchers can rely on this antibody to accurately detect histone H3 acetylation levels and gain insights into epigenetic regulation of gene expression.</p>

<p>Purified recombinant STRADA protein (His tag)</p>

<p>KLC1 antibody was raised in Rabbit using Human KLC1 as the immunogen</p>

<p>MAP3K11 antibody was raised using the middle region of MAP3K11 corresponding to a region with amino acids PVGQRSAKSPRREEEPRGGTVSPPPGTSRSAPGTPGTPRSPPLGLISRPR</p>

<p>The DPPA2 antibody is a monoclonal antibody that targets and neutralizes the growth factor DPPA2. It has been shown to inhibit caspase-9 activity, which plays a crucial role in apoptosis. This antibody is formulated with excipients such as histidine and colloidal globulin to enhance stability and efficacy. It can be used in various applications in Life Sciences, including research on mesenchymal stem cells and alpha-fetoprotein. The DPPA2 antibody is a highly specific and potent tool for studying the function of DPPA2 and its role in cellular processes.</p>

<p>Insulin antibody was raised in mouse using human insulin as the immunogen.</p>

<p>ZNF644 antibody was raised in rabbit using the middle region of ZNF644 as the immunogen</p>

<p>The MPL antibody is a powerful tool in the field of life sciences. It is a polyclonal antibody that specifically targets the myeloproliferative leukemia (MPL) receptor, which is a tyrosine kinase receptor involved in the regulation of hematopoiesis. This antibody has been extensively studied and has shown neutralizing activity against MPL ligands such as thrombopoietin, resulting in the inhibition of downstream signaling pathways.</p>

<p>ANP32A antibody was raised using a synthetic peptide corresponding to a region with amino acids FNCEVTNLNDYRENVFKLLPQLTYLDGYDRDDKEAPDSDAEGYVEGLDDE</p>

<p>The BSG antibody is a monoclonal antibody that specifically targets tumor necrosis factor-alpha (TNF-α). It is designed to bind to the glycan moiety of TNF-α, preventing its interaction with cell surface receptors. This antibody can be used in various research applications, such as immunohistochemistry and flow cytometry, to detect and quantify TNF-α levels. The BSG antibody has been extensively validated and shown to have high specificity and affinity for TNF-α. Its neutralizing properties make it a valuable tool for studying the role of TNF-α in various physiological and pathological processes. Additionally, this antibody has been used in therapeutic settings, such as the treatment of inflammatory diseases like rheumatoid arthritis, where excessive TNF-α production plays a key role in disease progression.</p>

<p>Purified recombinant TMED10 protein (His tag)</p>

<p>Purified recombinant Human OLA1 protein (His tag)</p>

<p>PHACTR3 antibody was raised using the C terminal of PHACTR3 corresponding to a region with amino acids IEMKLSKRLSQRPAVEELERRNILKQRNDQTEQEERREIKQRLTRKLNQR</p>

<p>The BRAF antibody is a highly specialized and reactive antibody that targets the activated form of the BRAF protein. This protein is involved in cell growth and plays a crucial role in various biological processes. The BRAF antibody is cytotoxic, meaning it has the ability to kill cells that express high levels of the activated BRAF protein.</p>

<p>Rabbit polyclonal DNAPK antibody</p>

<p>Purified Rabbit polyclonal BMP8B antibody</p>

<p>LEO1 antibody was raised in Rabbit using Human LEO1 as the immunogen</p>

<p>Rat monoclonal CCR7 antibody (biotin)</p>

<p>Rabbit polyclonal RNF138 antibody</p>

<p>Purified recombinant BMP6 protein (His tag)</p>

<p>Purified recombinant DEFB116 protein (His tag)</p>

<p>Rat monoclonal V alpha 2 TCR antibody (PE)</p>

<p>Aquaporin 7 antibody was raised using the C terminal of AQP7 corresponding to a region with amino acids DSVAYEDHGITVLPKMGSHEPTISPLTPVSVSPANRSSVHPAPPLHESMA</p>

<p>The TIE1 antibody is a highly specific antibody that targets the TIE1 protein, which is an important receptor involved in various biological processes. This monoclonal antibody is widely used in life sciences research to study the role of TIE1 in insulin signaling, adiponectin signaling, and growth factor regulation.</p>

<p>CYP3A43 antibody was raised using the C terminal of CYP3A43 corresponding to a region with amino acids IYALHHDPKYWTEPEKFCPESRFSKKNKDSIDLYRYIPFGAGPRNCIGMR</p>

<p>Mouse monoclonal CP15 antibody</p>

<p>Rabbit polyclonal OR10C1 antibody</p>

<p>Mouse monoclonal MAP2K4 antibody</p>

<p>The SERPINE1 antibody is a highly specialized antibody that targets the glutamate receptor. It belongs to the class of polyclonal antibodies and has been extensively studied in the field of Life Sciences. This antibody specifically interacts with β-catenin, a protein involved in cell adhesion and signaling pathways. It also inhibits the activity of colony-stimulating factors, which are important for immune response regulation. The SERPINE1 antibody has been shown to be reactive against various monoclonal antibodies, making it a versatile tool for research purposes. Additionally, it exhibits cytotoxic effects on pluripotent cells and can inhibit the activity of protein kinases, including oncogenic kinases. This monoclonal antibody is non-phosphorylated, ensuring its stability and effectiveness in experimental settings. With its wide range of applications in molecular biology and immunology research, the SERPINE1 antibody is an invaluable tool for scientists seeking to unravel complex cellular mechanisms.</p>

<p>Rabbit polyclonal RIMS3 antibody</p>

<p>ALDOC antibody was raised using the C terminal of ALDOC corresponding to a region with amino acids CPLPRPWALTFSYGRALQASALNAWRGQRDNAGAATEEFIKRAEVNGLAA</p>

<p>Mouse monoclonal PLEK antibody</p>

<p>Rabbit polyclonal PPAR gamma antibody (Ser112)</p>

<p>Rabbit polyclonal SPHK1 antibody</p>

<p>Purified recombinant JAM3 protein (His tag)</p>

<p>Rabbit polyclonal COL4A1 antibody (HRP)</p>

<p>Mouse monoclonal Myosin antibody</p>

<p>Mouse monoclonal EFNA2 antibody</p>

<p>The Keratin 18 antibody is a nanocomposite that consists of a DNA aptamer with an amino group. It can be used in Life Sciences research to study the growth factor and protein kinases involved in various cellular processes. The antibody specifically targets Keratin 18, which is a protein expressed in epithelial cells. This monoclonal antibody allows for the detection and visualization of Keratin 18 through an antigen-antibody reaction. It can be used in applications such as immunofluorescence staining, western blotting, and polymerase chain reactions (PCR). The Keratin 18 antibody is highly specific and sensitive, making it a valuable tool for researchers studying cellular biology and disease mechanisms.</p>

<p>Rabbit polyclonal GPR92 antibody</p>

<p>Purified Polyclonal MYST4 antibody</p>

<p>FSH antibody was raised in mouse using high purity intact FSH from human pituitary gland as the immunogen.</p>

<p>Haptoglobin antibody was raised against Human Haptoglobin.</p>

<p>PIGQ antibody was raised using the N terminal of PIGQ corresponding to a region with amino acids PTVLPDRQAGATTASTGGLAAVFDTVARSEVLFRSDRFDEGPVRLSHWQS</p>

<p>Mouse monoclonal NT5DC1 antibody</p>

<p>Purified recombinant HOXC11 protein (His tag)</p>

<p>Rabbit polyclonal Caspase 1 antibody (FITC)</p>

<p>Mouse monoclonal OMP28 antibody</p>

<p>Sheep polyclonal Sulphanitran antibody</p>

<p>RPL37A antibody was raised using the middle region of RPL37A corresponding to a region with amino acids CGKTKMKRRAVGIWHCGSCMKTVAGGAWTYNTTSAVTVKSAIRRLKELKD</p>

<p>Mouse monoclonal DPP9 antibody</p>

<p>Rabbit polyclonal CK2A1 antibody (Tyr255)</p>

<p>MGSSHHHHHH SSGLVPRGSH MAEDADMRNE LEEMQRRADQ LADESLESTR RMLQLVEESK DAGIRTLVML DEQGEQLERI EEGMDQINKD MKEAEKNLTD LGKFCGLCVC PCNKLKSSDA YKKAWGNNQD GVVASQPARV VDEREQMAIS GGFIRRVTND ARENEMDENL EQVSGIIGNL RHMALDMGNE IDTQNRQIDR IMEKADSNKT RIDEANQRAT KMLGSG</p>

<p>The TFR2 antibody is a highly effective tool in antiestrogen therapy. It specifically targets the histamine H4 receptor, which plays a crucial role in estrogen signaling pathways. By blocking this receptor, the TFR2 antibody effectively inhibits the growth and proliferation of estrogen-dependent tumors.</p>

<p>Purified Rabbit polyclonal ACVR1B antibody</p>

<p>Purified recombinant SIAH1 protein (His tag)</p>

<p>Avilamycin Conjugate for use in immunoassays</p>

<p>Purified Rabbit polyclonal EIF2AK1 antibody</p>

<p>UBE2M antibody was raised using a synthetic peptide corresponding to a region with amino acids IKLFSLKQQKKEEESAGGTKGSSKKASAAQLRIQKDINELNLPKTCDISF</p>

<p>NDUFA9 antibody was raised using a synthetic peptide corresponding to a region with amino acids QLHHALMPHGKGGRSSVSGIVATVFGATGFLGRYVVNHLGRMGSQVIIPY</p>

<p>The nNOS antibody is a highly effective tool in the field of atypical hemolytic research. It is specifically designed to target and detect brucella abortus, a bacterium that causes serious infections in animals and humans. This antibody belongs to the class of polyclonal antibodies, which means it can recognize multiple epitopes on the target protein.</p>

<p>Toxoplasma gondii protein is a versatile and essential component in the field of Life Sciences. This protein exhibits various characteristics that make it highly valuable for research purposes. It possesses epidermal growth factor properties, making it an excellent candidate for studying cellular growth and development. Additionally, Toxoplasma gondii protein has been found to have neutralizing effects, which can be utilized in the development of therapeutic interventions.</p>

<p>Sheep polyclonal Flunixin antibody</p>

<p>Purified recombinant PRRT2 protein (His tag)</p>

<p>Tead4 antibody was raised in rabbit using the middle region of Tead4 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of MYOZ1 antibody, catalog no. 70R-2197</p>

<p>Rabbit polyclonal KLHDC2 antibody</p>

<p>Rat monoclonal CIRE antibody (biotin)</p>

<p>Cathepsin B protein is a versatile enzyme that plays a crucial role in various biological processes. It is commonly used in research and diagnostic applications. Cathepsin B protein can be easily activated using an electrode or other suitable methods. It is often used in studies involving human serum, where it helps to understand the mechanisms of certain diseases. Monoclonal antibodies specific to Cathepsin B protein are available, which enable researchers to study its functions and interactions with other proteins. Recombinant proteins of Cathepsin B are also widely used in various experiments and assays.</p>

<p>Purified recombinant LRRC59 protein (His tag)</p>

<p>Halofuginone Conjugate for use in immunoassays</p>

<p>BAT5 antibody was raised using the middle region of BAT5 corresponding to a region with amino acids RAKLLACDGNEIDTMFVDRRGTAEPQGQKLVICCEGNAGFYEVGCVSTPL</p>

<p>GPT2 antibody was raised using a synthetic peptide corresponding to a region with amino acids EIKGQLVKLLSVRLCPPVSGQAAMDIVVNPPVAGEESFEQFSREKESVLG</p>

<p>The Beta-2-microglobulin monoclonal antibody is a highly specialized antibody that targets and interacts with beta-2-microglobulin, a protein found on the surface of various cells. This antibody has been extensively studied in the field of Life Sciences and has shown promising results in different applications.</p>

<p>IMPAD1 antibody was raised using the N terminal of IMPAD1 corresponding to a region with amino acids VLAAVRGGDEVRRVRESNVLHEKSKGKTREGAEDKMTSGDVLSNRKMFYL</p>

<p>Mouse monoclonal MPP5 antibody</p>

<p>The MDM2 antibody is a neutralizing monoclonal antibody that targets the MDM2 protein. It has been shown to inhibit the activity of interleukin-6 (IL-6) and tumor necrosis factor-alpha (TNF-α), two pro-inflammatory cytokines involved in immune responses. This antibody is reactive against adipose tissue and has been used in studies involving conditions such as obesity and metabolic disorders. Additionally, the MDM2 antibody has shown potential therapeutic effects against Brucella abortus, a bacterial pathogen that causes brucellosis. The colloidal gold-labeled MDM2 antibody can be used for immunohistochemistry or immunocytochemistry applications. This antibody also demonstrates inhibitory activity against certain family kinases and amyloid proteins. Overall, the MDM2 antibody offers a versatile tool for researchers studying various biological processes and diseases related to MDM2 and its associated pathways.</p>

<p>delta Catenin antibody was raised in mouse using synthetic peptide J6 (corresponding to aa 292-309) coupled to KLH as the immunogen.</p>

<p>Human IgG1 antibody was raised in mouse using IgG1 Fc region as the immunogen.</p>

<p>GPR61 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>Rabbit polyclonal SLP76 antibody</p>

<p>Sheep polyclonal Progesterone 4 antibody</p>

<p>TNF alpha antibody was raised in goat using highly pure recombinant murine TNF-alpha as the immunogen.</p>

<p>The MAFK antibody is a highly effective substance used in Life Sciences research. It is a recombinant antigen that specifically targets the polypeptide expression of MAFK, which plays a crucial role in various cellular processes. This antibody has been extensively studied and found to inhibit the activity of arginase, an enzyme involved in the metabolism of arginine. Additionally, it has shown potential as a therapeutic agent for non-alcoholic steatohepatitis (NASH) due to its ability to modulate the function of microvessel endothelial cells.</p>

<p>Purified recombinant USP15 protein (His tag)</p>

<p>Introducing the 6-Fluoro-3-indoxyl-beta-D-galactopyranoside: The Ultimate Antituberculosis Solution</p>

<p>Purified recombinant SGCD protein (His tag)</p>

<p>Rat monoclonal Toll-like receptor 9 antibody</p>

<p>Purified Rabbit polyclonal MRPS30 antibody</p>

<p>Purified Polyclonal GPR153 antibody</p>

<p>Mouse monoclonal C21orf59 antibody</p>

<p>The MYD88 antibody is a highly specialized product used in the field of Life Sciences. It is a monoclonal antibody that specifically targets and binds to MYD88, a protein involved in various cellular processes. This antibody has been extensively tested and validated for its efficacy and specificity.</p>

<p>TMB Substrate is a highly versatile and effective monoclonal antibody used in Life Sciences research. It is commonly used for the detection of growth factors and neutralizing inhibitors, particularly in studies related to oncostatin. This substrate offers exceptional sensitivity and produces a strong signal, making it ideal for various applications such as ELISA assays.</p>

<p>The DARPP32 antibody is a powerful tool in the field of Life Sciences and medicine. It is an inhibitor that targets the bromodomain, which plays a crucial role in proteolytic processes. This antibody has been shown to effectively inhibit tumor cell growth and metastasis by blocking the activity of metalloproteinases.</p>

<p>PDK2 antibody was raised using the middle region of PDK2 corresponding to a region with amino acids ELFKNAMRATVESHESSLILPPIKVMVALGEEDLSIKMSDRGGGVPLRKI</p>

<p>Rabbit polyclonal VAMP3 antibody</p>

<p>CAV1 antibody was raised in rabbit using a synthetic peptide corresponding to residues M(1) S G G K Y V D S E G H L Y T V P(17) C of human CAV1 as the immunogen.</p>

<p>Rabbit polyclonal RAB6A antibody</p>

<p>Rabbit polyclonal SHC4 antibody</p>

<p>Rabbit polyclonal CKMT antibody (FITC)</p>

<p>Purified Polyclonal Alpha adducin antibody</p>

<p>The TRIM46 antibody is a highly specialized antibody that targets specific proteins in the body. It has been extensively studied and proven to be effective in various applications within the field of Life Sciences. This monoclonal antibody has the ability to neutralize certain proteins, such as epidermal growth factor, collagen, and angptl3. By targeting these proteins, it can inhibit their activity and prevent unwanted cellular responses.</p>

<p>IL17 antibody was raised in goat using highly pure recombinant hIL-17A as the immunogen.</p>

<p>OVA conjugated Glutathione Hapten</p>

<p>CCND1 antibody was raised in rabbit using the N terminal of CCND1 as the immunogen</p>

<p>The cMet antibody is a highly effective inhibitor that targets low-density receptors in the Life Sciences field. It has been shown to significantly reduce cortisol concentration and inhibit the activity of androgen, thereby providing relief from various hormonal imbalances. This medicament is specifically designed to target antibodies, including trastuzumab and polyclonal antibodies, which are known to play a crucial role in autoimmune disorders. The cMet antibody works by blocking the activation of tyrosine kinases, which are responsible for initiating abnormal cell growth and proliferation. With its exceptional performance in laboratory assays, this antibody has proven to be a valuable tool for researchers and clinicians alike in the pursuit of understanding and combating autoimmune diseases.</p>

<p>The USP33 antibody is a highly specialized product in the field of Life Sciences. It is a polyclonal antibody that has been developed specifically for use in human hepatocytes. This antibody is used as a medicament to target specific proteins and molecules within the cells, such as collagen, lectins, cytotoxic elastase, and growth factors like TGF-beta. The USP33 antibody has been extensively tested and validated for its efficacy in detecting and quantifying these targets in various biological samples, including human serum and pancreatic elastase. Its high specificity and sensitivity make it an essential tool for researchers and scientists working in the field of molecular biology and biochemistry.</p>

<p>ABCC8 antibody was raised using a synthetic peptide corresponding to a region with amino acids PLAFCGSENHSAAYRVDQGVLNNGCFVDALNVVPHVFLLFITFPILFIGW</p>

<p>UMODL1 antibody was raised in rabbit using the middle region of UMODL1 as the immunogen</p>

<p>Mouse monoclonal CP4 EPSPS antibody</p>

<p>Mouse monoclonal IRF6 antibody</p>

<p>Mouse monoclonal MHC Class I antibody (FITC)</p>

<p>Mouse brain antibody was raised in rabbit using brain tissue from BALB/c mice as the immunogen.</p>

<p>LDL receptor antibody (biotin) was raised in rabbit using a specific synthetic peptide (sequence not conserved in VLDL receptor and LRP) of the LDL receptor extracellular domain as the immunogen.</p>

<p>Leukocyte protein is a versatile and essential component of the immune system. It plays a crucial role in the body's defense against pathogens and foreign substances. This protein is involved in various processes, including antigen recognition, antibody production, and immune response regulation.</p>

<p>Purified Rabbit polyclonal CK1 alpha antibody (Thr321)</p>

<p>The HBP1 antibody is a powerful tool in the field of Life Sciences. It specifically targets epidermal growth factor and IL-17A, which are important factors in various biological processes. This antibody acts as an inhibitory factor, neutralizing the activity of these growth factors. With its high specificity and affinity, the HBP1 antibody is ideal for research purposes, such as studying cell signaling pathways and investigating the role of IL-17A in disease development. It is a polyclonal antibody produced from multiple sources, ensuring reliable and consistent results. The HBP1 antibody recognizes specific amino groups and hydroxyl groups on the target proteins, making it a valuable tool for detecting and quantifying their presence in samples. Whether you are studying leukemia inhibitory factor or interleukin-6 activation, the HBP1 antibody will provide accurate and reproducible data to advance your research.</p>

<p>Purified native Rabbit Troponin I protein (Cardiac)</p>

<p>bFGF antibody was raised in Mouse using recombinant human bFGF as the immunogen.</p>

<p>Rabbit polyclonal CDK11A antibody (HRP)</p>

<p>IgM antibody was raised in Mouse using recombinant human IgM as the immunogen.</p>

<p>LAPAQ is a hydroxyl-containing fatty acid that is synthesized by the liver and is used as a co-therapy for lowering low-density lipoprotein cholesterol. LAPAQ has been shown to have a chemical stability that is 8 times higher than that of other drugs, which may be due to its ester linkages. This drug also has anti-inflammatory properties, which are due to its ability to inhibit the production of high-sensitivity c-reactive protein (hsCRP). LAPAQ inhibits the activity of 3 enzymes involved in cholesterol synthesis, including 3-hydroxy-3-methylglutaryl coenzyme A reductase (HMG CoA reductase), acetyl coenzyme A cholesterol acyltransferase (ACAT), and lysophospholipid acyltransferase. It also inhibits the transcriptional regulation of low density lipoprotein cholesterols.</p>

<p>Purified recombinant PLAC8 protein (His tag)</p>

<p>hCG beta protein is an activated protein that plays a crucial role in various biological processes. It has been shown to induce the production of interleukin-6 (IL-6) in human serum, which is important for immune responses and inflammation regulation. In Life Sciences, hCG beta protein is used as a target antigen in DNA vaccine development and collagen research. Specific antibodies against hCG beta protein can be used for ultrasensitive detection in diagnostic assays. Additionally, hCG beta protein can be immobilized on a carbon electrode to enhance the sensitivity of electrochemical biosensors. This versatile protein is also used as a reference standard for the quantification of other proteins, such as alpha-fetoprotein. With its wide range of applications, hCG beta protein is an essential tool for researchers working with Native Proteins &amp; Antigens, DNA aptamers, and monoclonal antibodies.</p>

<p>POLK antibody was raised using a synthetic peptide corresponding to a region with amino acids ATECTLEKTDKDKFVKPLEMSHKKSFFDKKRSERKWSHQDTFKCEAVNKQ</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug belonging to the rifamycins class. It is specifically designed to target tuberculosis infections and contains active compounds that exhibit bactericidal activity. Through its unique mechanism of action, this drug inhibits bacterial growth by binding to DNA-dependent RNA polymerase, preventing transcription and replication. Extensive research has shown its high efficacy in human erythrocytes using a patch-clamp technique. The metabolization process involves various transformations such as hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it selectively binds to markers expressed in Mycobacterium tuberculosis strains, leading to inhibition of cell growth in culture.</p>

<p>SERPIND1 antibody was raised using a synthetic peptide corresponding to a region with amino acids VSMMQTKGNFLAANDQELDCDILQLEYVGGISMLIVVPHKMSGMKTLEAQ</p>

<p>C2ORF25 antibody was raised using the middle region of C2Orf25 corresponding to a region with amino acids RAEGYWADFIDPSSGLAFFGPYTNNTLFETDERYRHLGFSVDDLGCCKVI</p>

<p>The ERBB2 antibody is a monoclonal antibody that acts as a family kinase inhibitor. It specifically targets the epidermal growth factor receptor 2 (ERBB2), which is known to play a critical role in the growth and proliferation of cancer cells. This antibody effectively inhibits the binding of growth factors, such as epidermal growth factor and interleukin-6, to the ERBB2 receptor, thereby preventing the activation of downstream signaling pathways that promote tumor growth.</p>

<p>Mouse monoclonal JEV PreM antibody</p>

<p>Rabbit polyclonal RPC4 antibody</p>

<p>Ubiquilin 3 antibody was raised using the N terminal of UBQLN3 corresponding to a region with amino acids LMRQHVSVPEFVTQLIDDPFIPGLLSNTGLVRQLVLDNPHMQQLIQHNPE</p>

<p>The DEFB1 antibody is a growth factor and family kinase inhibitor protein that is widely used in Life Sciences research. This specific antibody is designed to bind to DEFB1, also known as human beta-defensin 1. It has been extensively validated for its high specificity and affinity towards DEFB1, making it an essential tool for studying the function and regulation of this important protein.</p>

<p>The S6 antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It is specifically designed to target and neutralize collagen, a protein that plays a crucial role in various biological processes. This antibody has been extensively tested and proven to be effective in inhibiting collagen's genotoxic effects.</p>

<p>Purified Polyclonal NAV3 antibody</p>

<p>Borrelia burgdorferi antibody was raised in rabbit using a whole cell preparation from Borrelia burgdorferi as the immunogen.</p>

<p>Purified recombinant RPS4X protein (His tag)</p>

<p>NUDC antibody was raised using a synthetic peptide corresponding to a region with amino acids DAENHEAQLKNGSLDSPGKQDTEEDEEEDEKDKGKLKPNLGNGADLPNYR</p>

<p>The HES1 antibody is a highly specific monoclonal antibody used in Life Sciences research. It targets the HES1 protein, which plays a crucial role in various cellular processes such as cell differentiation and proliferation. This antibody is commonly utilized in studies involving collagen, alpha-fetoprotein, helicobacter, androgen, annexin, and epidermal growth factor.</p>

<p>STK38 antibody was raised using the C terminal of STK38 corresponding to a region with amino acids IGAPGVEEIKSNSFFEGVDWEHIRERPAAISIEIKSIDDTSNFDEFPESD</p>

<p>Claudin 19 antibody was raised using the C terminal of CLDN19 corresponding to a region with amino acids AVLGGSFLCCTCPEPERPNSSPQPYRPGPSAAAREPVVKLPASAKGPLGV</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of HYAL1 antibody, catalog no. 70R-9002</p>

<p>Mouse monoclonal TCP11L2 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ARGFX antibody, catalog no. 70R-8696</p>

<p>TRIM36 antibody was raised using the middle region of TRIM36 corresponding to a region with amino acids GYIMELIAKGKASAMGLQQTHEHSRLTSKGGEARCPFEISEVGKQSLPRR</p>

<p>The Calponin antibody is a highly specialized product in the field of Life Sciences. It belongs to the category of Monoclonal Antibodies and is designed for use in human serum. This antibody is specifically designed to target and bind to calponin, a protein involved in various cellular processes.</p>

<p>Mouse monoclonal CD20 antibody (biotin)</p>

<p>HAV VP1 antibody is a monoclonal antibody that specifically targets the HAV VP1 protein. This antibody can be used in various applications, including immunoassays and protein detection. The HAV VP1 antibody is highly specific and exhibits strong binding affinity to the target protein, ensuring accurate and reliable results.</p>

<p>TNF alpha antibody was raised in rabbit using highly pure recombinant murine TNF-alpha as the immunogen.</p>

<p>C9ORF4 antibody was raised using the middle region of C9Orf4 corresponding to a region with amino acids HDDNGRVRIQHFYNVGQWAKEIQRNPARDEEGVFENNRVTCRFKRPVNVP</p>

<p>WDR55 antibody was raised using the middle region of WDR55 corresponding to a region with amino acids AKKLLLTASGDGCLGIFNIKRRRFELLSEPQSGDLTSVTLMKWGKKVACG</p>

<p>Rabbit polyclonal VEGFR2 antibody (Tyr1054)</p>

<p>The Histone H1 antibody is a powerful tool used in Life Sciences research. This monoclonal antibody specifically targets and neutralizes histone H1, an important protein involved in chromatin structure and gene regulation. It has been extensively tested and validated for use in various applications, including Western blotting, immunohistochemistry, and immunofluorescence.</p>

<p>06:0-06:0 NBD pc is a mouse monoclonal antibody that recognizes the extracellular domain of the human protein, calcitonin receptor-like receptor (CLR). CLR is a GPCR that is activated by calcitonin and mediates Ca2+ signaling. 06:0-06:0 NBD pc has been used to study protein interactions, ion channels, and cell biology. 06:0-06:0 NBD pc has also been used as a research tool in pharmacology and life sciences.</p>

<p>EVX2 antibody was raised in rabbit using the middle region of EVX2 as the immunogen</p>

<p>PPM1K antibody was raised using a synthetic peptide corresponding to a region with amino acids AHAVTEQAIQYGTEDNSTAVVVPFGAWGKYKNSEINFSFSRSFASSGRWA</p>