Biochemicals and Reagents

<p>Purified recombinant Human EIF1AY protein</p>

<p>NRCAM antibody was raised using the N terminal of NRCAM corresponding to a region with amino acids NLSDTEFYGAKSSRERPPTFLTPEGNASNKEELRGNVLSLECIAEGLPTP</p>

<p>PPP5C antibody was raised in rabbit using the middle region of PPP5C as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of GP9 antibody, catalog no. 70R-10332</p>

<p>HYLS1 antibody was raised using the middle region of HYLS1 corresponding to a region with amino acids YFEYKRDWDSIRLPGEDHRKELRWGVREQMLCRAEPQSKPQHIYVPNNYL</p>

<p>Rabbit polyclonal PPP1CC antibody</p>

<p>CXCL9 antibody was raised in rabbit using the middle region of CXCL9 as the immunogen</p>

<p>Purified Polyclonal GPR175 antibody</p>

<p>Purified recombinant Human BAT1 protein</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CLDN5 antibody, catalog no. 70R-6137</p>

<p>Goat anti-human kappa chain (FITC) was raised in goat using human kappa free chain as the immunogen.</p>

<p>FCN1 antibody was raised in rabbit using the middle region of FCN1 as the immunogen</p>

<p>Rabbit polyclonal ETV4 antibody</p>

<p>GAD65 antibody is a polyclonal antibody that is commonly used in Life Sciences research. This antibody specifically targets the enzyme glutamate decarboxylase 65 (GAD65). GAD65 plays a crucial role in the synthesis of gamma-aminobutyric acid (GABA), an inhibitory neurotransmitter in the central nervous system. The cytotoxic effects of GAD65 antibodies have been studied in various research models, including androgen-treated prostate cancer cells, where it was found to inhibit cell proliferation and induce apoptosis.</p>

<p>PROCA1 antibody was raised using the middle region of PROCA1 corresponding to a region with amino acids GELSSEDIVESSSPRKRENTVQAKKTGAKPSQARKVNKRKSPPGSNPNLS</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of OTUB2 antibody, catalog no. 70R-9724</p>

<p>Rabbit Polyclonal Zap70 antibody (Tyr319)</p>

<p>Sheep anti-rabbit IgG (H+L) (Rhodamine) was raised in sheep using rabbit IgG whole molecule as the immunogen.</p>

<p>SF3B1 antibody was raised using the N terminal of SF3B1 corresponding to a region with amino acids ERLDPFADGGKTPDPKMNARTYMDVMREQHLTKEEREIRQQLAEKAKAGE</p>

<p>Purified recombinant Human ECHDC1 protein (His tag)</p>

<p>Ligatin antibody was raised using the middle region of LGTN corresponding to a region with amino acids KVTVVRNLEAYGLDPYSVAAILQQRCQASTTVNPAPGAKDSLQVQIQGNQ</p>

<p>LAG3 antibody was raised in rabbit using the C terminal of LAG3 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of DDX55 antibody, catalog no. 70R-1380</p>

<p>HSPA5 antibody was raised in Mouse using a purified recombinant fragment of human HSPA5 expressed in E. coli as the immunogen.</p>

<p>Affinity purified Rabbit polyclonal Histone H3.3B antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF529 antibody, catalog no. 70R-8093</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of RNF20 antibody, catalog no. 70R-2098</p>

<p>The HSP10 antibody is a highly specialized antibody that has cytotoxic properties. It targets transthyretin, which is a protein involved in various cellular processes including protein folding and transport. The HSP10 antibody can inhibit the activity of transthyretin by binding to it and preventing its interaction with other proteins or enzymes.</p>

<p>Mouse monoclonal CD57 antibody (FITC)</p>

<p>Purified recombinant Wnt3a protein (Mouse)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ANXA8L2 antibody, catalog no. 70R-6044</p>

<p>CYP3A4 antibody was raised in Rabbit using Human CYP3A4 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of TRIM49 antibody, catalog no. 70R-2764</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of TSPYL6 antibody, catalog no. 70R-1994</p>

<p>Rabbit polyclonal PDLIM7 antibody</p>

<p>The S6K1 antibody is a highly specialized antibody that has been developed for use in the field of Life Sciences. It is specifically designed to target and bind to the S6K1 protein, which plays a crucial role in various cellular processes, including cell growth and metabolism. This antibody has been extensively tested and validated to ensure its efficacy and specificity.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SYNCRIP antibody, catalog no. 70R-1309</p>

<p>Purified recombinant ING2 protein (His tag)</p>

<p>The Fascin 1 antibody is a highly specialized monoclonal antibody that targets and binds to the protein Fascin 1. Fascin 1 is involved in various cellular processes, including cell adhesion, migration, and cytoskeletal organization. This antibody has been extensively studied in Life Sciences research and has shown inhibitory properties against Fascin 1 activity.</p>

<p>The CD174 antibody is a powerful tool for targeted therapy in the field of immunology. It specifically targets an antigen that plays a crucial role in various immune responses. This antibody-drug complex has been shown to inhibit the activity of interleukin-6 (IL-6), a key cytokine involved in inflammatory processes. By binding to the nuclear region of cells, the CD174 antibody effectively neutralizes IL-6 and prevents its interaction with cell receptors.</p>

<p>P2ry1 antibody was raised in rabbit using the middle region of P2ry1 as the immunogen</p>

<p>The CXCL10 antibody is a monoclonal antibody that specifically targets the chemokine CXCL10. It is a human protein and has been shown to have neutralizing properties. This antibody can be used as a medicament for various applications, including immunoassays and polymerase chain reactions (PCR). It is commonly used in research settings to detect and quantify CXCL10 levels in biological samples. The CXCL10 antibody can also be used in antigen-antibody reactions to study the interaction between CXCL10 and other molecules, such as acetylcholine or autoantibodies. With its high specificity and reactivity, this antibody is an essential tool for studying the role of CXCL10 in various physiological and pathological processes.</p>

<p>CCL5 antibody was raised in rabbit using the middle region of CCL5 as the immunogen</p>

<p>The APP antibody is a growth factor that plays a crucial role in various biological processes. It is involved in the regulation of collagen synthesis, making it essential for maintaining the integrity of tissues and organs. This antibody is widely used in Life Sciences research, particularly in the field of Polyclonal Antibodies.</p>

<p>The NUR77 antibody is a highly effective monoclonal antibody used in Life Sciences research. It is specifically designed to target and inhibit the growth factor NUR77, which plays a crucial role in various cellular processes. This antibody has been extensively studied and proven to be highly specific and potent in its inhibitory effects.</p>

<p>CDR2 antibody was raised using the N terminal of CDR2 corresponding to a region with amino acids MLAENLVEEFEMKEDEPWYDHQDLQQDLQLAAELGKTLLDRNTELEDSVQ</p>

<p>Rabbit polyclonal CNOT4 antibody</p>

<p>Rabbit anti Monkey IgG (H + L) secondary antibody</p>

<p>DCK antibody was raised using the middle region of DCK corresponding to a region with amino acids QLASLNGKLKDAEKPVLFFERSVYSDRYIFASNLYESECMNETEWTIYQD</p>

<p>Rabbit polyclonal AROS antibody (FITC)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CCT6B antibody, catalog no. 70R-4432</p>

<p>Purified Polyclonal RASA3 antibody</p>

<p>Purified Polyclonal EEF1B2 antibody</p>

<p>CLIC2 antibody was raised using the C terminal of CLIC2 corresponding to a region with amino acids SAEEPPVSRRLFLDGDQLTLADCSLLPKLNIIKVAAKKYRDFDIPAEFSG</p>

<p>Rabbit anti-Human PIEZO1 Polyclonal antibody</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is specifically designed to target tuberculosis infections and contains active compounds that exhibit bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, which prevents transcription and replication, ultimately inhibiting bacterial growth. The efficacy of this drug has been extensively studied using advanced techniques like the patch-clamp technique on human erythrocytes. It undergoes various metabolic transformations such as hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it binds to markers expressed in high levels in Mycobacterium tuberculosis strains and effectively inhibits cell growth in culture.</p>

<p>CD2 antibody was raised in rat using CD2/LFA-2 as the immunogen.</p>

<p>GDAP1L1 antibody was raised in Rabbit using Human GDAP1L1 as the immunogen</p>

<p>Affinity purified Rabbit polyclonal DNAI2 antibody</p>

<p>ASPA antibody was raised using a synthetic peptide corresponding to a region with amino acids RIFDLENLGKKMSEDLPYEVRRAQEINHLFGPKDSEDSYDIIFDLHNTTS</p>

<p>SR140 antibody was raised using the middle region of SR140 corresponding to a region with amino acids KVAPSKWEAVDESELEAQAVTTSKWELFDQHEESEEEENQNQEEESEDEE</p>

<p>Rabbit polyclonal PSTPIP2 antibody</p>

<p>IL16 antibody was raised in Rabbit using Human IL16 as the immunogen</p>

<p>Purified recombinant T cruzi 1F8 protein (His tag)</p>

<p>Rabbit polyclonal IFM3 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of C1QTNF4 antibody, catalog no. 70R-5437</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of FBXO8 antibody, catalog no. 70R-3127</p>

<p>Purified Polyclonal AHRL antibody</p>

<p>HMGCL antibody was raised using a synthetic peptide corresponding to a region with amino acids LATEDLVYMLEGLGIHTGVNLQKLLEAGNFICQALNRKTSSKVAQATCKL</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CCDC28A antibody, catalog no. 70R-9315</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an antituberculosis drug that falls under the class of rifamycins. It is known for its potent bactericidal activity against tuberculosis infection. By binding to DNA-dependent RNA polymerase, it inhibits bacterial growth and prevents transcription and replication. This active compound has been extensively studied using the patch-clamp technique on human erythrocytes. Metabolized through various transformations, such as hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid, it exhibits high efficacy against Mycobacterium tuberculosis strains. Experience the power of 6-Fluoro-3-indoxyl-beta-D-galactopyranoside in combating tuberculosis infection.</p>

<p>Mouse monoclonal LENG1 antibody</p>

<p>GSPT1 antibody was raised in Rabbit using Human GSPT1 as the immunogen</p>

<p>OVA conjugated Chenodeoxycholic acid Hapten</p>

<p>Region of IL4 protein corresponding to amino acids MHGCNDSPLR EIINTLNQVT EKGTPCTEMF VPDVLTATRN TTENELICRA SRVLRKFYFP RDVPPCLKNK SGVLGELRKL CRGVSGLNSL RSCTVNESTL TTLKDFLESL KSILRGKYLQ SCTSMS.</p>

<p>Nucleolin antibody was raised using the N terminal of NCL corresponding to a region with amino acids GKALVATPGKKGAAIPAKGAKNGKNAKKEDSDEEEDDDSEEDEEDDEDED</p>

<p>The DLX5 antibody is a highly specialized and potent tool in the field of life sciences. It is a polyclonal antibody that specifically targets DLX5, a transcription factor involved in various cellular processes. This antibody can be used for research purposes, such as studying the role of DLX5 in development and disease progression.</p>

<p>Rabbit polyclonal RPS18 antibody</p>

<p>Mouse monoclonal CD10 antibody (biotin)</p>

<p>Rabbit polyclonal TBX15/18 antibody</p>

<p>Mouse monoclonal PTPN1 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of TNNI1 antibody, catalog no. 70R-3601</p>

<p>The C1S antibody is a monoclonal antibody that belongs to the field of Life Sciences. It specifically targets an insulin-like antigen and has been shown to play a role in sumoylation, which is the process of attaching Small Ubiquitin-like Modifier (SUMO) proteins to target proteins. This antibody can be used in various research applications, including the study of tyrosine signaling pathways and the detection of alpha-synuclein, a protein associated with neurodegenerative disorders.</p>

<p>Affinity purified Rabbit polyclonal RGS14 antibody</p>

<p>Rabbit polyclonal CPI17 alpha antibody (Thr38)</p>

<p>Rabbit polyclonal DNAJB4 antibody</p>

<p>Rabbit polyclonal PDGFR beta antibody (Tyr740)</p>

<p>Rabbit polyclonal SSTR4 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ZGPAT antibody, catalog no. 70R-4430</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of H1FOO antibody, catalog no. 70R-2025</p>

<p>Rabbit Polyclonal cdc25C antibody (Ser216)</p>

<p>Armcx1 antibody was raised in rabbit using the C terminal of Armcx1 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ANKRD5 antibody, catalog no. 70R-3386</p>

<p>Mouse monoclonal NUDT6 antibody</p>

<p>Desmocollin 2 antibody is a monoclonal antibody that has been specifically developed for use in Life Sciences research. It is produced by hybridoma cells and is activated to ensure optimal performance. This antibody targets desmocollin 2, which is an important protein involved in cell adhesion. By binding to desmocollin 2, this antibody can be used to study its function and role in various biological processes.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ZBTB11 antibody, catalog no. 70R-8309</p>

<p>Rabbit polyclonal AML1 antibody (Ser435)</p>

<p>Rabbit polyclonal CHMP2A antibody</p>

<p>Rabbit polyclonal TRP antibody (HRP)</p>

<p>Rabbit Polyclonal AMPK1 antibody (Thr174)</p>

<p>Rabbit polyclonal SPCS1 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ZDHHC21 antibody, catalog no. 70R-4550</p>

<p>Purified Polyclonal PNPLA8 antibody</p>

<p>ERH antibody was raised in Rabbit using Human ERH as the immunogen</p>

<p>Rabbit polyclonal cAbl antibody</p>

<p>Purified recombinant MTCP1 protein (His tag)</p>

<p>Purified Polyclonal S100A1 antibody</p>

<p>CMTM2 antibody was raised using the N terminal of CMTM2 corresponding to a region with amino acids DKPQKAVQDHKEPSDKPQKAVQPKHEVGTRRGCRRYRWELKDSNKEFWLL</p>

<p>MMP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids YPKMIAHDFPGIGHKVDAVFMKDGFFYFFHGTRQYKFDPKTKRILTLQKA</p>

<p>Purified native Hemoglobin protein (Guinea Pig)</p>

<p>The SMARCD3 antibody is a monoclonal antibody that targets the tyrosinase enzyme. It has been shown to inhibit the activity of tyrosinase, which plays a crucial role in melanogenesis. This antibody specifically binds to tyrosinase and forms an antigen-antibody complex, leading to the inhibition of its function.</p>

<p>Triclabendazole Conjugate for use in immunoassays</p>

<p>Purified Polyclonal ABHD14A antibody</p>

<p>CAP2 antibody was raised in Rabbit using Human CAP2 as the immunogen</p>

<p>PABPC1L2A antibody was raised using a synthetic peptide corresponding to a region with amino acids NGMFLNYRKIFVGRFKSHKEREAERGAWARQSTSADVKDFEEDTDEEATL</p>

<p>RanBP1 antibody was raised using the C terminal of RANBP1 corresponding to a region with amino acids KFEECRKEIEEREKKAGSGKNDHAEKVAEKLEALSVKEETKEDAEEKQ</p>

<p>Purified Polyclonal CLCNKA antibody</p>

<p>Astrovirus antibody was raised in mouse using group antigen of astrovirus as the immunogen.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of HAGH antibody, catalog no. 70R-4214</p>

<p>Rabbit polyclonal RPS10 antibody</p>

<p>The PTHR1 antibody is a monoclonal antibody used in Life Sciences research. It specifically targets the PTHR1 molecule, which is activated by carbonic anhydrase and plays a crucial role in various physiological processes. This antibody can be used to study the interaction between PTHR1 and other molecules, such as virus surface antigens or growth factors. Additionally, the PTHR1 antibody has been shown to have anticoagulant properties and can neutralize fibrinogen-induced platelet aggregation. Its efficacy has been confirmed using mass spectrometric methods, making it a reliable tool for researchers in the field.</p>

<p>Rabbit polyclonal Lamin A/B antibody</p>

<p>Rabbit polyclonal p62Dok antibody</p>

<p>Mouse monoclonal KHK antibody</p>

<p>Rabbit polyclonal CYP3A43 antibody</p>

<p>Purified recombinant Human S100A5 protein</p>

<p>Recombinant human CENPH protein</p>

<p>hCG beta antibody (HRP) was raised in mouse using hCG beta as the immunogen.</p>

<p>DYSFIP1 antibody was raised using the middle region of DYSFIP1 corresponding to a region with amino acids CSDGYPDIARYLISLGADRDATNDDGDLPSDLIDPDYKELVELFKGTTMD</p>

<p>Rabbit polyclonal ARL2 antibody (biotin)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of COPG2 antibody, catalog no. 70R-3831</p>

<p>Rabbit polyclonal CARKL antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of MAT2B antibody, catalog no. 70R-3571</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PGBD3 antibody, catalog no. 70R-1365</p>

<p>MUS81 antibody was raised in rabbit using the C terminal of MUS81 as the immunogen</p>

<p>The LTBR antibody is a highly specialized Polyclonal Antibody that targets the LTBR protein. This antibody is essential in various Life Sciences research applications, including the study of cholinergic signaling, fibronectin interactions, and autoantibodies. The LTBR antibody has been shown to have neutralizing properties, inhibiting the activity of LTBR and its downstream signaling pathways.</p>

<p>Rabbit polyclonal THG1L antibody</p>

<p>Rabbit polyclonal MRE11 antibody (Ser264)</p>

<p>ATXN10 antibody was raised in rabbit using the N terminal of ATXN10 as the immunogen</p>

<p>The TRAF5 antibody is a biomolecule that belongs to the group of polyclonal antibodies. It can be used as a diagnostic reagent in the field of Life Sciences. This antibody specifically binds to TRAF5, which is an important protein involved in various cellular processes, including signaling pathways and immune responses. The TRAF5 antibody has been shown to have high affinity for TRAF5 and can be used for detection and quantification of this protein in biological samples.</p>

<p>FER antibody was raised in Mouse using a purified recombinant fragment of human FER expressed in E. coli as the immunogen.</p>

<p>Rabbit polyclonal XAB2 antibody</p>

<p>KCNRG antibody was raised using the N terminal of KCNRG corresponding to a region with amino acids MSSQELVTLNVGGKIFTTRFSTIKQFPASRLARMLDGRDQEFKMVGGQIF</p>

<p>SLC6A5 antibody was raised using a synthetic peptide corresponding to a region with amino acids LIVTCTNSATSIFAGFVIFSVIGFMANERKVNIENVADQGPGIAFVVYPE</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SLC26A10 antibody, catalog no. 70R-8407</p>

<p>PON1 antibody was raised using the C terminal of PON1 corresponding to a region with amino acids ASEVLRIQNILTEEPKVTQVYAENGTVLQGSTVASVYKGKLLIGTVFHKA</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of RPL37A antibody, catalog no. 70R-3004</p>

<p>Human growth hormone antibody (HRP) was raised in mouse using human growth hormone as the immunogen.</p>

<p>Mouse monoclonal LMAN1 antibody</p>

<p>The IRS1 antibody is a highly specialized molecule drug used in the field of Life Sciences. It belongs to the class of Polyclonal Antibodies and is primarily used for targeting insulin signaling pathways. This antibody specifically binds to the IRS1 protein, which plays a crucial role in mediating insulin's effects on glucose metabolism and growth factor signaling.</p>

<p>IgA antibody was raised in Mouse using recombinant human IgA2 as the immunogen.</p>

<p>FBXO3 antibody was raised in Rabbit using Human FBXO3 as the immunogen</p>

<p>The SHH antibody is a monoclonal antibody that targets the Sonic Hedgehog (SHH) protein. This protein is involved in various cellular processes, including cell growth and differentiation. The SHH antibody specifically binds to the SHH protein, neutralizing its activity.</p>

<p>Purified recombinant Human ARG2 protein</p>

<p>MPPED2 antibody was raised using the N terminal of MPPED2 corresponding to a region with amino acids RFQPPHVHMVDPIPYDTPKPAGHTRFVCISDTHSRTDGIQMPYGDILLHT</p>

<p>C21orf66 antibody was raised in rabbit using the N terminal of C21ORF66 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of TAF7L antibody, catalog no. 20R-1187</p>

<p>APOA-I antibody was raised in rabbit using human apoliprotein A-I as the immunogen.</p>

<p>Rabbit polyclonal PFDN2 antibody</p>

<p>The GLUR1 antibody is a reactive antibody that specifically targets the IL-1 receptor, an important component of the interleukin signaling pathway. This antibody is widely used in Life Sciences research to study the role of IL-1 in various biological processes. Additionally, it has been shown to inhibit the production of pancreatic glucagon, a hormone involved in regulating blood sugar levels.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF19 antibody, catalog no. 70R-1055</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of GSTA5 antibody, catalog no. 70R-2975</p>

<p>PRDX5 antibody was raised using the middle region of PRDX5 corresponding to a region with amino acids TDLLLDDSLVSIFGNRRLKRFSMVVQDGIVKALNVEPDGTGLTCSLAPNI</p>

<p>Rabbit Polyclonal NFkB p105/p50 antibody</p>

<p>NDUFB3 antibody was raised in Rabbit using Human NDUFB3 as the immunogen</p>

<p>GABPB1 antibody was raised in Rabbit using Human GABPB1 as the immunogen</p>

<p>SRP68 antibody was raised using the N terminal of SRP68 corresponding to a region with amino acids EENKENERPSAGSKANKEFGDSLSLEILQIIKESQQQHGLRHGDFQRYRG</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of RAPSN antibody, catalog no. 70R-2650</p>

<p>ACER1 antibody was raised in rabbit using the C terminal of ACER1 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PDS5B antibody, catalog no. 70R-2864</p>

<p>Goat anti-human IgG (H+L) (FITC) was raised in goat using human IgG whole molecule as the immunogen.</p>

<p>Affinity purified Rabbit polyclonal Edc3 antibody</p>

<p>MAD2L1BP antibody was raised in rabbit using the N terminal of MAD2L1BP as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of C13orf28 antibody, catalog no. 70R-3516</p>

<p>CPS1 antibody was raised using the N terminal of CPS1 corresponding to a region with amino acids QWLQEEKVPAIYGVDTRMLTKIIRDKGTMLGKIEFEGQPVDFVDPNKQNL</p>

<p>RNASEL antibody was raised in rabbit using the C terminal of RNASEL as the immunogen</p>

<p>The ARNT antibody is a highly specialized product in the field of Life Sciences. It is an antigen that targets the nuclear receptor subfamily 1 group D member 1 (ARNT) protein. This antibody is designed to specifically bind to the ARNT protein, which plays a crucial role in cellular processes such as hemagglutination and cell antigen presentation.</p>

<p>Recombinant human ZFAND3 protein (His tag)</p>

<p>Affinity purified Rabbit polyclonal SPG7 antibody</p>

<p>SURF6 antibody was raised using the N terminal of SURF6 corresponding to a region with amino acids ICSHSAPEQQARTRAGKTQGSETAGPPKKKRKKTQKKFRKREEKAAEHKA</p>

<p>GBP2 antibody was raised using the N terminal of GBP2 corresponding to a region with amino acids HYVTELTDRIKANSSPGNNSVDDSADFVSFFPAFVWTLRDFTLELEVDGE</p>