Biochemicals and Reagents

<p>CSNK1A1L antibody was raised in rabbit using the middle region of CSNK1A1L as the immunogen</p>

<p>Rabbit polyclonal ZMY11 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of MTFMT antibody, catalog no. 70R-8800</p>

<p>The G3BP1 antibody is a highly specialized product used in the field of Life Sciences. This monoclonal antibody is designed to specifically target and bind to G3BP1, an important protein involved in cellular processes. The G3BP1 antibody can be used for various applications, including immunoassays, Western blotting, and immunohistochemistry.</p>

<p>The MLH1 antibody is a highly effective tool in the field of Life Sciences. It is an activated antibody that acts as a family kinase inhibitor, targeting specific proteins involved in cellular processes. This monoclonal antibody specifically binds to MLH1, a protein involved in DNA repair and maintenance of genomic stability.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of AP2B1 antibody, catalog no. 70R-3422</p>

<p>AP3B1 antibody was raised in Rabbit using Human AP3B1 as the immunogen</p>

<p>ACOT9 antibody was raised in rabbit using the N terminal of ACOT9 as the immunogen</p>

<p>ZNF570 antibody was raised in rabbit using the N terminal of ZNF570 as the immunogen</p>

<p>The Anti-CDV antibody is a monoclonal antibody that is commonly used in Life Sciences research. It has the ability to neutralize the activity of CDV (Canine Distemper Virus), an infectious disease that affects dogs. This antibody specifically targets and binds to CDV, preventing it from infecting cells and causing harm. Additionally, the Anti-CDV antibody has been found to be reactive against other amyloid proteins, making it a valuable tool for studying amyloid-related diseases such as Alzheimer's disease. It can be used in various applications, including immunohistochemistry, Western blotting, and ELISA assays. The Anti-CDV antibody is supplied in a buffered solution and is stable for long-term storage.</p>

<p>HPSE antibody was raised in Rabbit using Human HPSE as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CBLN4 antibody, catalog no. 70R-5300</p>

<p>The FGL2 antibody is a monoclonal antibody that specifically targets the amino-terminal region of FGL2, a natriuretic protein. This antibody has been extensively studied in various life science assays and has shown great potential for use in research and diagnostic applications.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ARHGAP15 antibody, catalog no. 70R-9489</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the category of rifamycins. It is widely recognized as the most effective rifamycin for treating tuberculosis infections. By binding to DNA-dependent RNA polymerase, this drug inhibits bacterial growth, preventing transcription and replication. The potency of this medication has been demonstrated through extensive testing using the patch-clamp technique on human erythrocytes. Metabolized through various transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid, it effectively targets Mycobacterium tuberculosis strains and impedes their growth in culture.</p>

<p>Mouse monoclonal DTYMK antibody</p>

<p>MAPK7 antibody was raised in Rabbit using Human MAPK7 as the immunogen</p>

<p>Sheep polyclonal Spiramycin antibody</p>

<p>MAPK10 antibody was raised in Rabbit using Human MAPK10 as the immunogen</p>

<p>Integrin beta 7 antibody is a monoclonal antibody that targets the integrin beta 7 protein. This protein plays a crucial role in various cellular processes, including keratinocyte growth and the response to growth factors. The antibody has been shown to have cytotoxic effects on cells expressing alpha-fetoprotein, making it a potential therapeutic option for certain types of cancer. Additionally, Integrin beta 7 antibody can be used as a research tool in studies investigating the function of integrins and their involvement in various diseases. Its neutralizing properties make it an effective tool for blocking integrin-mediated signaling pathways.</p>

<p>Rabbit polyclonal Myb antibody (Ser532)</p>

<p>Mouse monoclonal PYCRL antibody</p>

<p>Mouse monoclonal TNNI3 antibody</p>

<p>Mouse monoclonal RAB17 antibody</p>

<p>Dhrs3 antibody was raised in rabbit using the middle region of Dhrs3 as the immunogen</p>

<p>Thioredoxin antibody was raised in Mouse using purified recombinant fusion protein with Thioredoxin (TRX) tag as the immunogen.</p>

<p>Mouse monoclonal PPWD1 antibody</p>

<p>Lgals4 antibody was raised in rabbit using the C terminal of Lgals4 as the immunogen</p>

<p>The THC antibody is a monoclonal antibody that specifically targets and neutralizes tetrahydrocannabinol (THC), the main psychoactive compound found in cannabis. This antibody has been extensively studied in the field of life sciences and has shown promising results in various assays.</p>

<p>The STIM1 antibody is a monoclonal antibody that is used in the field of life sciences. It is specifically designed to target and bind to the STIM1 protein, which plays a crucial role in cellular signaling pathways. This antibody has been extensively studied and proven to be highly effective in detecting and quantifying STIM1 protein levels in various biological samples.</p>

<p>PFKL antibody was raised using the middle region of PFKL corresponding to a region with amino acids RTNVLGHLQQGGAPTPFDRNYGTKLGVKAMLWLSEKLREVYRKGRVFANA</p>

<p>RGD1563533 antibody was raised in rabbit using the middle region of RGD1563533 as the immunogen</p>

<p>The HDAC10 antibody is a monoclonal antibody that targets the growth factor tyrosine, which plays a crucial role in cell growth and proliferation. This antibody has cytotoxic properties, meaning it can selectively kill cells that express high levels of the target protein. It has been shown to inhibit the activity of lysozyme, dopamine, and alpha-synuclein, which are involved in various cellular processes. The HDAC10 antibody can also be used in combination with other antibodies or drugs, such as trastuzumab, to enhance their effectiveness. Additionally, this antibody has been studied in the field of Life Sciences and has shown potential therapeutic applications for conditions such as thrombocytopenia. Its ability to bind to specific proteins, including insulin-like growth factor binding proteins, makes it a valuable tool for research and development in various scientific disciplines.</p>

<p>Rabbit polyclonal SH2D3A antibody</p>

<p>Caldesmon 1 antibody was raised using the middle region of CALD1 corresponding to a region with amino acids FSSPTAAGTPNKETAGLKVGVSSRINEWLTKTPDGNKSPAPKPSDLRPGD</p>

<p>Mouse monoclonal C21orf34 antibody</p>

<p>METAP2 antibody was raised using the N terminal of METAP2 corresponding to a region with amino acids ATGKKKKKKKKKRGPKVQTDPPSVPICDLYPNGVFPKGQECEYPPTQDGR</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CAMLG antibody, catalog no. 70R-2352</p>

<p>CD34 antibody was raised in Mouse using a purified recombinant fragment of CD34 expressed in E. coli as the immunogen.</p>

<p>Rabbit polyclonal ABHD6 antibody</p>

<p>Mouse anti Rabbit IgG is a monoclonal antibody that specifically targets and binds to rabbit immunoglobulin G (IgG). It is commonly used in various research applications, particularly in the field of life sciences. This antibody can be utilized as a primary or secondary antibody for detecting and quantifying target proteins in samples.</p>

<p>Lipoprotein Lipase Monoclonal Antibody (HRP)</p>

<p>Purified Polyclonal AIRE antibody</p>

<p>KCTD21 antibody was raised using the N terminal of KCTD21 corresponding to a region with amino acids RDGKVFRYILNFLRTSHLDLPEDFQEMGLLRREADFYQVQPLIEALQEKE</p>

<p>Rabbit polyclonal RPL5 antibody (biotin)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PGS1 antibody, catalog no. 70R-1011</p>

<p>Rabbit polyclonal PCK1 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of TMEM35 antibody, catalog no. 70R-7193</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of C2orf47 antibody, catalog no. 70R-4100</p>

<p>BIN2 antibody was raised in rabbit using the middle region of BIN2 as the immunogen</p>

<p>Purified Rabbit polyclonal OR5M10 antibody</p>

<p>The KRAS antibody is a potent monoclonal antibody that specifically targets the KRAS protein, a key player in cell growth and division. This antibody has been extensively studied in Life Sciences and has shown promising results in inhibiting the activity of KRAS, which is often found to be mutated in various types of cancer. By binding to the KRAS protein, this antibody prevents its interaction with growth factors and downstream signaling pathways, ultimately leading to the inhibition of tumor cell proliferation. Additionally, the KRAS antibody has been shown to activate anti-icos antibodies and chemokines, which play important roles in immune response regulation. With its high specificity and affinity, this antibody holds great potential for therapeutic applications in cancer treatment.</p>

<p>EIF4E2 antibody was raised in rabbit using the N terminal of EIF4E2 as the immunogen</p>

<p>ADHFE1 antibody was raised in Rabbit using Human ADHFE1 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ZBTB9 antibody, catalog no. 70R-8437</p>

<p>This antibody reacts with heavy chains on hamster IgG and light chains on all hamster immunoglobulins.</p>

<p>Rat PMN antibody (FITC) was raised in rabbit using rat PMNs as the immunogen.</p>

<p>Rabbit polyclonal PCDHA6 antibody</p>

<p>The EDD antibody is a monoclonal antibody that has neutralizing properties. It is specifically designed to target and bind to glycan molecules, thereby inhibiting the activity of TNF-α (tumor necrosis factor-alpha) and erythropoietin. This antibody is commonly used in ophthalmic formulations and in Life Sciences research for the detection and analysis of biomolecules. Additionally, the EDD antibody can be utilized in various assays to measure enzyme activity, such as phosphatase or lipoprotein lipase. Its high specificity and affinity make it an excellent tool for studying chemokines and other related proteins. For researchers looking for a reliable antibody with diverse applications, the EDD antibody is an ideal choice.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PPP1R11 antibody, catalog no. 70R-3745</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of STK38 antibody, catalog no. 70R-5769</p>

<p>GALK1 antibody was raised in rabbit using the C terminal of GALK1 as the immunogen</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the category of rifamycins. It is known for its exceptional efficacy in treating tuberculosis infections. This active compound exhibits bactericidal activity by binding to DNA-dependent RNA polymerase, preventing transcription and replication. Its effectiveness has been demonstrated through patch-clamp technique studies on human erythrocytes. The drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits their growth in culture.</p>

<p>Goat polyclonal Human Serum Albumin antibody (FITC) conjugated</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of FAM36A antibody, catalog no. 70R-4394</p>

<p>Mouse monoclonal DNAAF1 antibody</p>

<p>Mouse monoclonal QPRT antibody</p>

<p>Chst11 antibody was raised in rabbit using the C terminal of Chst11 as the immunogen</p>

<p>Rabbit polyclonal Collagen V alpha 1 antibody</p>

<p>Vasopressin antibody was raised in rabbit using arginine vasopressin-thyroglobulin as the immunogen.</p>

<p>Mouse monoclonal QPRT antibody</p>

<p>The GAB1 antibody is a monoclonal antibody that specifically targets the activated form of GAB1, a human protein involved in various cellular processes. This antibody has been extensively studied in the field of life sciences and has shown promising results. It has been found to inhibit the activity of GAB1 and its downstream signaling pathways, including those involved in alpha-fetoprotein production and colony-stimulating factor release. Additionally, this antibody has demonstrated minimal toxic effects on cells and tissues, making it a safe and effective tool for research purposes. With its high specificity and affinity for GAB1, the GAB1 antibody is an invaluable resource for scientists studying cellular signaling pathways and their role in disease development.</p>

<p>Purified recombinant Human Tau protein</p>

<p>Purified Polyclonal PFKFB2 antibody</p>

<p>GALNT6 antibody was raised using the N terminal of GALNT6 corresponding to a region with amino acids MNNLRDSMPKLQIRAPEAQQTLFSINQSCLPGFYTPAELKPFWERPPQDP</p>

<p>TNF alpha antibody was raised in Mouse using recombinant human TNF alpha as the immunogen.</p>

<p>Purified recombinant Human AKR1D1 protein</p>

<p>Purified Polyclonal KIAA1967 antibody</p>

<p>Mouse monoclonal TNF alpha antibody (biotin)</p>

<p>DNAJB14 antibody was raised in Rabbit using Human DNAJB14 as the immunogen</p>

<p>Factor B antibody was raised against Human Factor B (C3 Proactivator).</p>

<p>B3GALNT2 antibody was raised using the middle region of B3GALNT2 corresponding to a region with amino acids GKWQELEYPSPAYPAFACGSGYVISKDIVKWLASNSGRLKTYQGEDVSMG</p>

<p>C3orf20 antibody was raised in Rabbit using Human C3orf20 as the immunogen</p>

<p>Affinity purified Rabbit polyclonal ARF1 antibody</p>

<p>TST antibody is a polypeptide expression of autoantibodies that specifically target the protein kinase. This antibody is widely used in Life Sciences research to study the role of protein kinases in various cellular processes. It has been shown to be effective in detecting and quantifying protein kinase activity in microvessel endothelial cells. TST antibody can also be used as a recombinant antigen for biochemical assays and interferon detection. Additionally, it has been utilized to investigate collagen-related diseases and evaluate the effects of inhibitors on protein kinase activity. With its versatility and specificity, TST antibody is an essential tool for researchers studying a wide range of biological processes, including non-alcoholic steatohepatitis and food extract analysis.</p>

<p>Rabbit polyclonal SFRS9 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of LDLRAD3 antibody, catalog no. 70R-9224</p>

<p>MAGEL2 antibody was raised in rabbit using the C terminal of MAGEL2 as the immunogen</p>

<p>The nNOS antibody is a highly specialized product in the field of Life Sciences. This monoclonal antibody acts as an inhibitory factor against neuronal nitric oxide synthase (nNOS), an enzyme involved in the production of nitric oxide in neurons. By specifically binding to nNOS, this antibody blocks its activity and prevents the production of nitric oxide.</p>

<p>CHST1 antibody was raised using a synthetic peptide corresponding to a region with amino acids YRLWRLWYGTGRKPYNLDVTQLTTVCEDFSNSVSTGLMRPPWLKGKYMLV</p>

<p>Rabbit polyclonal CtBP1 antibody (Ser422)</p>

<p>1-858 amino acids: MRGSHHHHHH GMASMTGGQQ MGRDLYDDDD KDRWGSMSVV GLDVGSQSCY IAVARAGGIE TIANEFSDRC TPSVISFGSK NRTIGVAAKN QQITHANNTV SNFKRFHGRA FNDPFIQKEK ENLSYDLVPL KNGGVGIKVM YMGEEHLFSV EQITAMLLTK LKETAENSLK KPVTDCVISV PSFFTDAERR SVLDAAQIVG LNCLRLMNDM TAVALNYGIY KQDLPSLDEK PRIVVFVDMG HSAFQVSACA FNKGKLKVLG TAFDPFLGGK NFDEKLVEHF CAEFKTKYKL DAKSKIRALL RLYQECEKLK KLMSSNSTDL PLNIECFMND KDVSGKMNRS QFEELCAELL QKIEVPLYSL LEQTHLKVED VSAVEIVGGA TRIPAVKERI AKFFGKDIST TLNADEAVAR GCALQCAILS PAFKVREFSV TDAVPFPISL IWNHDSEDTE GVHEVFSRNH AAPFSKVLTF LRRGPFELEA FYSDPQGVPY PEAKIGRFVV QNVSAQKDGE KSRVKVKVRV NTHGIFTIST ASMVEKVPTE ENEMSSEADM ECLNQRPPEN PDTDKNVQQD NSEAGTQPQV QTDAQQTSQS PPSPELTSEE NKIPDADKAN EKKVDQPPEA KKPKIKVVNV ELPIEANLVW QLGKDLLNMY IETEGKMIMQ DKLEKERNDA KNAVEEYVYE FRDKLCGPYE KFICEQDHQN FLRLLTETED WLYEEGEDQA KQAYVDKLEE LMKIGTPVKV RFQEAEERPK MFEELGQRLQ HYAKIAADFR NKDEKYNHID ESEMKKVEKS VNEVMEWMNN VMNAQAKKSL DQDPVVRAQE IKTKIKELNN TCEPVVTQPK PKIESPKLER TPNGPNIDKK EEDLEDKNNF GAEPPHQNGE CYPNEKNSVN MDLD</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of LYK5 antibody, catalog no. 70R-2049</p>

<p>OLR1 antibody was raised using a synthetic peptide corresponding to a region with amino acids QANLTHQKKKLEGQISARQQAEEASQESENELKEMIETLARKLNEKSKEQ</p>

<p>Rabbit polyclonal Alpha synuclein antibody (biotin)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ZHX2 antibody, catalog no. 20R-1178</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the category of rifamycins. It is specifically designed to combat tuberculosis infections by targeting the active compounds responsible for bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, which inhibits bacterial growth and prevents transcription and replication. Its effectiveness has been extensively tested using the patch-clamp technique on human erythrocytes. The active form of this drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically binds to markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits cell growth in culture.</p>

<p>The GFAP antibody is a monoclonal antibody widely used in the field of Life Sciences. It specifically targets and neutralizes the glial fibrillary acidic protein (GFAP), which is an important antigen involved in various cellular processes. This antibody has been extensively tested and proven to be highly effective in assays related to interferon, transferrin, anti-hbs, low-density lipoprotein, fatty acid metabolism, and other related research areas. With its high specificity and affinity, the GFAP antibody is a valuable tool for scientists and researchers studying the role of GFAP in different biological systems. It comes with all necessary excipients for optimal performance and is available in various formats to suit different experimental needs. Trust the GFAP antibody to provide reliable and accurate results for your research endeavors.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF485 antibody, catalog no. 70R-8418</p>

<p>Purified native Chicken Desmin protein</p>

<p>The Fractalkine antibody is a powerful anticoagulant that belongs to the class of monoclonal antibodies. It works by targeting and neutralizing the virus surface antigen, preventing its ability to cause harm. This antibody has been extensively studied and characterized using mass spectrometric methods, ensuring its high quality and effectiveness. In addition to its anticoagulant properties, the Fractalkine antibody also acts as a chemokine, attracting immune cells to the site of infection and promoting an effective immune response. It has been shown to activate 3-kinase signaling pathways and enhance interferon production. The Fractalkine antibody is available in both polyclonal and monoclonal forms, providing options for different research needs. With its exceptional performance and reliability, this antibody is a valuable tool in Life Sciences research.</p>

<p>The BNP antibody is an acidic polyclonal antibody that targets the growth factor B-type natriuretic peptide (BNP). It is commonly used in Life Sciences research to study the role of BNP in various physiological processes. The BNP antibody specifically binds to BNP and inhibits its interaction with receptors, thereby modulating endothelial growth and insulin signaling pathways. This antibody can also be used for diagnostic purposes to measure BNP levels in patient samples. Additionally, the BNP antibody has been utilized as a therapeutic agent in targeted cancer therapies, particularly in combination with anti-HER2 antibodies like trastuzumab. With its high specificity and affinity for BNP, this monoclonal antibody offers researchers and clinicians a valuable tool for studying and manipulating the natriuretic peptide system.</p>

<p>17b-Testosterone 3 Conjugate for use in immunoassays</p>

<p>22-362 amino acids: MGSSHHHHHH SSGLVPRGSH MRENILFGMG NPLLDISAVV DKDFLDKYSL KPNDQILAED KHKELFDELV KKFKVEYHAG GSTQNSIKVA QWMIQQPHKA ATFFGCIGID KFGEILKRKA AEAHVDAHYY EQNEQPTGTC AACITGDNRS LIANLAAANC YKKEKHLDLE KNWMLVEKAR VCYIAGFFLT VSPESVLKVA HHASENNRIF TLNLSAPFIS QFYKESLMKV MPYVDILFGN ETEAATFARE QGFETKDIKE IAKKTQALPK MNSKRQRIVI FTQGRDDTIM ATESEVTAFA VLDQDQKEII DTNGAGDAFV GGFLSQLVSD KPLTECIRAG HYAASIIIRR TGCTFPEKPD FH</p>

<p>ApoC-III protein is a glycoprotein that plays a crucial role in lipid metabolism and cardiovascular health. It is involved in the regulation of triglyceride levels by inhibiting lipoprotein lipase, an enzyme responsible for breaking down triglycerides. ApoC-III also interacts with various proteins and molecules, including fibrinogen, collagen, and tyrosine, contributing to its multifunctional nature. This protein has garnered significant interest in the medical and scientific communities due to its potential implications in cardiovascular diseases and metabolic disorders. Researchers have developed autoantibodies and monoclonal antibodies targeting ApoC-III as potential therapeutic agents for managing hypertriglyceridemia and related conditions. Furthermore, studies have shown that ApoC-III exhibits anticoagulant properties by interfering with the activation of blood clotting factors. This characteristic makes it a valuable component in colloidal solutions used for preventing clot formation during medical procedures. In addition to its role in lipid metabolism</p>

<p>Please enquire for more information about Hemoglobin Powder (bovine) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF682 antibody, catalog no. 70R-8400</p>

<p>KLHL2 antibody was raised in Rabbit using Human KLHL2 as the immunogen</p>

<p>Rabbit polyclonal HLX1 antibody</p>

<p>Rabbit polyclonal PFD5 antibody (biotin)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of BTBD15 antibody, catalog no. 70R-8088</p>

<p>RPS21 antibody was raised using the N terminal of RPS21 corresponding to a region with amino acids MQNDAGEFVDLYVPRKCSASNRIIGAKDHASIQMNVAEVDKVTGRFNGQF</p>

<p>The ERH antibody is a monoclonal antibody that targets the ERH protein. This protein is involved in various cellular processes, including insulin signaling and glutamate metabolism. The ERH antibody specifically recognizes the amino group of the ERH protein and can be used in various applications, such as Western blotting and immunohistochemistry.</p>

<p>Purified Polyclonal PITP beta antibody</p>

<p>Ofloxacin-BSA</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PLEKHB2 antibody, catalog no. 70R-4316</p>

<p>GPX2 antibody was raised in rabbit using the middle region of GPX2 as the immunogen</p>

<p>UNC5A antibody was raised using a synthetic peptide corresponding to a region with amino acids VYCRKKEGLDSDVADSSILTSGFQPVSIKPSKADNPHLLTIQPDLSTTTT</p>

<p>Rabbit polyclonal SAV1 antibody</p>

<p>Purified recombinant ECI1 protein (His tag)</p>

<p>Rabbit Polyclonal Myc antibody (Thr58)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF335 antibody, catalog no. 70R-8365</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF546 antibody, catalog no. 70R-8163</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of IGSF1 antibody, catalog no. 70R-6035</p>

<p>TMCO4 antibody was raised in rabbit using the C terminal of TMCO4 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of UGT2A3 antibody, catalog no. 70R-7206</p>

<p>Sheep polyclonal Lasalocid antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PLS3 antibody, catalog no. 70R-3756</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of TMEM168 antibody, catalog no. 70R-6246</p>

<p>Rabbit polyclonal TOMM22 antibody</p>

<p>Rabbit polyclonal RTP1 antibody</p>

<p>The GLUT4 antibody is a monoclonal antibody that plays a crucial role in glucose absorption and sugar metabolism. It specifically targets the insulin-regulated aminopeptidase, which is responsible for the transportation of glucose into adipose tissue. By binding to this target, the GLUT4 antibody enhances glucose uptake and promotes its storage as glycogen.</p>

<p>Rabbit Polyclonal Synuclein antibody (Ser129)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PDZK1 antibody, catalog no. 70R-3097</p>

<p>This antibody reacts with heavy chains on Guinea Pig IgG and light chains on all Guinea Pig immunoglobulins.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of DDB2 antibody, catalog no. 70R-10002</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of UBE2C antibody, catalog no. 70R-5585</p>

<p>Rabbit Polyclonal OR8H3 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of EXOC5 antibody, catalog no. 70R-3820</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PHACTR3 antibody, catalog no. 70R-2298</p>

<p>Mouse monoclonal LDLRAP1 antibody</p>

<p>Rabbit polyclonal SRF antibody (Ser99)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CYP2B6 antibody, catalog no. 70R-5412</p>

<p>PIP5KL1 antibody was raised using the middle region of PIP5KL1 corresponding to a region with amino acids VLDYSLLIAFQRLHEDERGPGSSLIFRTARSVQGAQSPEESRAQNRRLLP</p>

<p>The p53 antibody is a monoclonal antibody that is used for immunohistochemical detection. It specifically targets the p53 protein, which plays a crucial role in regulating cell growth and preventing tumor formation. The p53 antibody binds to the tetramerization domain of the p53 protein, allowing for its detection in various tissues and cells. This antibody has been widely used in research and diagnostic applications to study the expression and localization of p53 in different diseases, including cancer. Its high specificity and sensitivity make it a valuable tool for understanding the molecular mechanisms underlying tumor development and progression.</p>

<p>Fresh tissue lysate isolated from the striatum of human brain</p>

<p>RAD23A antibody was raised using a synthetic peptide corresponding to a region with amino acids  VPSSGSSGREEDAASTLVTGSEYETMLTEIMSMGYERERVVAALRASYNN</p>

<p>PPFIBP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids PFMGSLRALHLVEDLRGLLEMMETDEKEGLRCQIPDSTAETLVEWLQSQM</p>

<p>Scfd2 antibody was raised in rabbit using the middle region of Scfd2 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CYP2A7 antibody, catalog no. 70R-7501</p>

<p>Delta Catenin antibody was raised in Guinea Pig using synthetic peptide J7 coupled to KLH as the immunogen.</p>

<p>Human RBC antibody was raised in rabbit using human erythrocytes as the immunogen.</p>

<p>Mouse monoclonal RfbE antibody</p>

<p>Mouse monoclonal DLD antibody</p>

<p>KDM5A antibody was raised in Rabbit using Human KDM5A as the immunogen</p>

<p>PRAME antibody was raised using the N terminal of PRAME corresponding to a region with amino acids AMVQAWPFTCLPLGVLMKGQHLHLETFKAVLDGLDVLLAQEVRPRRWKLQ</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ACTR2 antibody, catalog no. 70R-1197</p>

<p>CLPS antibody was raised in Rabbit using Human CLPS as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of P2RX7 antibody, catalog no. 70R-5097</p>

<p>The PKR antibody is a highly effective tool used in Life Sciences research. It is available as both polyclonal and monoclonal antibodies, providing researchers with multiple options for their experiments. This antibody specifically targets the protein kinase RNA-activated (PKR) enzyme, which plays a crucial role in regulating cellular responses to various stimuli. The PKR antibody can be utilized in a wide range of assays, including Western blotting, immunohistochemistry, and immunofluorescence.</p>

<p>The eIF2 alpha antibody is a polyclonal antibody used in Life Sciences research. It specifically targets and binds to eIF2 alpha, a protein involved in the regulation of translation initiation. This antibody is commonly used in studies related to insulin signaling, as well as in the development of therapeutic antibodies like trastuzumab and metoclopramide. In addition, it can be used as a tool for detecting eIF2 alpha autoantibodies or as a marker for identifying cells expressing high levels of this protein. The eIF2 alpha antibody has been proven to be highly specific and sensitive, making it an essential component in various research applications.</p>

<p>Purified Rabbit polyclonal ERF antibody (Thr526)</p>

<p>The SCGF antibody is a peptide agent that belongs to the globulin class of proteins. It is widely used in Life Sciences research as a growth factor and basic protein. This antibody acts as an anticoagulant and can be used in various applications such as immunoassays, western blotting, and immunohistochemistry. The SCGF antibody can also be conjugated with streptavidin for enhanced detection or used in combination with monoclonal antibodies for neutralizing specific targets. Additionally, this antibody has been shown to have catalase activity, making it useful for studying oxidative stress and antioxidant mechanisms in human serum. With its versatility and high specificity, the SCGF antibody is an invaluable tool for researchers in a wide range of fields.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of TXN2 antibody, catalog no. 70R-2433</p>

<p>S100 antibody was raised in rabbit using S-100 protein from bovine brain as the immunogen.</p>

<p>Mouse monoclonal MAPK8 antibody</p>

<p>Rabbit polyclonal GPR25 antibody</p>

<p>IRX3 antibody was raised in rabbit using the N terminal of IRX3 as the immunogen</p>

<p>Rabbit polyclonal THRB antibody</p>

<p>TMEM132B antibody was raised using the middle region of TMEM132B corresponding to a region with amino acids VQEWFHRGTPVGQEESTNKSTTPQSPMEGKNKLLKSGGPDAFTSFPTQGK</p>

<p>This antibody reacts with heavy chains on chicken IgG (IgY) and light chains on all chicken immunoglobulins.</p>

<p>GEMIN6 antibody was raised in Rabbit using Human GEMIN6 as the immunogen</p>

<p>Goat anti-cat IgG (FITC) was raised in goat using feline IgG F(ab')2 fragment as the immunogen.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ALDH3A2 antibody, catalog no. 70R-6587</p>

<p>NRIP1 antibody was raised in mouse using recombinant Human Nuclear Receptor Interacting Protein 1 (Nrip1)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PRKACA antibody, catalog no. 70R-4594</p>

<p>The CD29 antibody is a highly effective monoclonal antibody that has a wide range of applications in the field of Life Sciences. It is particularly useful for detecting autoantibodies and alpha-fetoprotein, as well as for studying the function of various proteins and glycopeptides. The CD29 antibody can also be used to investigate the role of arginase and leukemia inhibitory factor in different biological processes.</p>

<p>Recombinant Human CST7 protein with His tag</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of Arnt antibody, catalog no. 70R-7857</p>

<p>Rabbit polyclonal PDIA3 antibody (FITC)</p>

<p>The PNMT antibody is an extracellular antigen that plays a crucial role in reductive processes. It can be used in various applications, including adeno-associated virus research and the development of therapeutic antibodies. The PNMT antibody is a highly specific monoclonal antibody that targets the activated form of the PNMT protein complex. It has been extensively tested and shown to have neutralizing properties against multidrug-resistant strains. This antibody is widely used in the life sciences field for its ability to detect and study low-density protein complexes. With its high specificity and soluble nature, the PNMT antibody is an invaluable tool for researchers in need of reliable and accurate detection methods.</p>