Biochemicals and Reagents

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ATG4A antibody, catalog no. 70R-2866</p>

<p>Rabbit polyclonal MMP7 antibody (FITC)</p>

Rabbit Polyclonal Crk2 antibody (Try221)

EGF antibody was raised in Mouse using a purified recombinant fragment of human EGF expressed in E. coli as the immunogen.

<p>ACRV1 antibody was raised in Rabbit using Human ACRV1 as the immunogen</p>

Human IgE antibody was raised in mouse using human myeloma IgE as the immunogen.

<p>Rabbit anti-human IgM (Rhodamine) was raised in rabbit using human IgM (Fc5m) fragment as the immunogen.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of NCBP1 antibody, catalog no. 70R-4645</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of 9030625A04Rik antibody, catalog no. 70R-9217</p>

Ankyrin antibody was raised in mouse using purified human erythroid cells ankyrin as the immunogen.

C20ORF20 antibody was raised using the middle region of C20Orf20 corresponding to a region with amino acids LSTMYDMQALHESEILPFPNPERNFVLPEEIIQEVREGKVMIEEEMKEEM

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of Ebf3 antibody, catalog no. 70R-7935</p>

<p>TNFSF13 antibody was raised in rabbit using the middle region of TNFSF13 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of MYPN antibody, catalog no. 70R-10045</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ADAMTS6 antibody, catalog no. 70R-10203</p>

<p>DUS3L antibody was raised in Rabbit using Human DUS3L as the immunogen</p>

<p>CBX6 antibody was raised in rabbit using the N terminal of CBX6 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of VEGFA antibody, catalog no. 70R-10216</p>

<p>THYN1 antibody was raised using the N terminal of THYN1 corresponding to a region with amino acids MSRPRKRLAGTSGSDKGLSGKRTKTENSGEALAKVEDSNPQKTSATKNCL</p>

PCSK1 antibody was raised using the middle region of PCSK1 corresponding to a region with amino acids QSPKKSPSAKLNIPYENFYEALEKLNKPSQLKDSEDSLYNDYVDVFYNTK

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of METTL1 antibody, catalog no. 70R-1155</p>

Purified Polyclonal Carbonic Anhydrase 14 antibody

<p>Rabbit polyclonal AAK1 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of HERC5 antibody, catalog no. 70R-5524</p>

<p>Affinity purified Rabbit polyclonal AIF1 antibody</p>

<p>JMJD5 antibody was raised in rabbit using the middle region of JMJD5 as the immunogen</p>

<p>Recombinant human NAE1 protein (His tag)</p>

Goat anti-human IgM (Fab'2) was raised in goat using human IgM Fc5mu fragment as the immunogen.

<p>CD34 antibody was raised in rabbit using the C terminal of CD34 as the immunogen</p>

<p>Rabbit polyclonal SFRS5 antibody</p>

The GRF1 antibody is a monoclonal antibody used in Life Sciences research. It specifically targets and binds to the cyclase-activating domain of GRF1, a protein involved in the regulation of cellular functions. This antibody has been extensively tested and shown to have high specificity and affinity for its target. It can be used in various applications such as Western blotting, immunohistochemistry, and flow cytometry. The GRF1 antibody is also capable of neutralizing the activity of interferon-gamma (IFN-gamma), making it a valuable tool for studying immune responses. With its wide range of applications and reliable performance, this antibody is an essential component of any research involving GRF1 or IFN-gamma signaling pathways.

<p>Rabbit polyclonal HP1 alpha antibody (Ser92)</p>

CXORF26 antibody was raised using the middle region of Cxorf26 corresponding to a region with amino acids IYSEFRKNFETLRIDVLDPEELKSESAKEKWRPFCLKFNGIVEDFNYGTL

<p>Rabbit polyclonal MAP3K4 antibody</p>

<p>Goat anti-human IgM (Alk Phos) was raised in goat using human IgM mu mu chain as the immunogen.</p>

Histone H4 (mono methyl K20) Monoclonal Antibody

<p>Affinity purified Rabbit polyclonal HICE1 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of EFEMP1 antibody, catalog no. 70R-2375</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of NFKBIE antibody, catalog no. 70R-8262</p>

<p>Rabbit Polyclonal AMPKB1 antibody (Ser182)</p>

Rabbit Polyclonal PAK1 antibody (Thr212)

<p>PBEF1 antibody was raised using the C terminal of PBEF1 corresponding to a region with amino acids  CSYVVTNGLGINVFKDPVADPNKRSKKGRLSLHRTPAGNFVTLEEGKGDL</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CHCHD8 antibody, catalog no. 70R-9459</p>

Purified homogeneous preparation of PE conjugated Streptavidin protein

<p>CD25 antibody (Azide free) was raised in rat using alpha chain IL-2 receptor as the immunogen.</p>

<p>PPP6R1 antibody was raised using the N terminal of PPP6R1 corresponding to a region with amino acids MFWKFDLHTSSHLDTLLEREDLSLPELLDEEDVLQECKVVNRKLLDFLLQ</p>

<p>Rabbit polyclonal GPI antibody (biotin)</p>

<p>The Tau antibody is a highly specialized antibody that targets the epidermal growth factor (EGF) receptor. It is available in both polyclonal and monoclonal forms, making it suitable for a wide range of research applications in the field of Life Sciences.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CCDC16 antibody, catalog no. 70R-8105</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of GNAS antibody, catalog no. 70R-1651</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of EPOR antibody, catalog no. 70R-5994</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of A1BG antibody, catalog no. 70R-1579</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ZAP70 antibody, catalog no. 70R-10263</p>

Cytokeratin 19 protein is a biomolecule that plays a crucial role in the field of Life Sciences. It serves as an important marker for various cellular processes and is commonly used in research and diagnostic applications. Cytokeratin 19 protein can be targeted using interferons or monoclonal antibodies to study its function and interactions with other molecules.

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SLC36A3 antibody, catalog no. 70R-1801</p>

Factor IX antibody (FITC) was raised in goat using human Factor IX purified from plasma as the immunogen.

<p>TRPM3 antibody was raised using the N terminal of TRPM3 corresponding to a region with amino acids YLRDTPPVPVVVCDGSGRASDILAFGHKYSEEGGLINESLRDQLLVTIQK</p>

<p>The Uromodulin antibody is a highly specialized biotinylated antibody that is used in various research applications in the field of Life Sciences. This antibody specifically targets and binds to uromodulin, a protein found in high concentrations in human hepatocytes. The Uromodulin antibody has been extensively characterized and validated for its specificity and sensitivity.</p>

<p>The p53 antibody is a highly specialized product in the field of Life Sciences. It belongs to the category of monoclonal antibodies and is specifically designed to target the p53 protein, which plays a crucial role in regulating cell growth and preventing tumor formation.</p>

A synthetic peptide for use as a blocking control in assays to test for specificity of SMYD3 antibody, catalog no. 70R-8964

HCK antibody was raised in Mouse using a purified recombinant fragment of HCK expressed in E. coli as the immunogen.

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SF3B1 antibody, catalog no. 70R-4704</p>

<p>The Lamin A antibody is a specific antibody that is used as a medicament in various applications. It has the ability to bind to activated Lamin A, which plays a crucial role in regulating gene expression and maintaining the structural integrity of the nucleus. This antibody can be used for research purposes, such as studying protein-protein interactions or investigating the localization and function of Lamin A in different cell types.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ORAI1 antibody, catalog no. 70R-6459</p>

<p>Region of Vaspin protein corresponding to amino acids MLKPSFSPRN YKALSEVQGW KQRMAAKELA RQNMDLGFKL LKKLAFYNPG RNIFLSPLSI STAFSMLCLG AQDSTLDEIK QGFNFRKMPE KDLHEGFHYI IHELTQKTQD LKLSIGNTLF IDQRLQPQRK FLEDAKNFYS AETILTNFQN LEMAQKQIND FISQKTHGKI NNLIENIDPG TVMLLANYIF FRARWKHEFD PNVTKEEDFF LEKNSSVKVP MMFRSGIYQV GYDDKLSCTI LEIPYQKNIT AIFILPDEGK LKHLEKGLQV DTFSRWKTLL SRRVVDVSVP RLHMTGTFDL KKTLSYIGVS KIFEEHGDLT KIAPHRSLKV GEAVHKAELK MDERGTEGAA GTGAQTLPME TPLVVKIDKP YLLLIYSEKI PSVLFLGKIV NPIGK.</p>

<p>Rabbit polyclonal 14-3-3 theta tau antibody (Ser232)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of GSTM3 antibody, catalog no. 70R-5232</p>

<p>Purified Rabbit polyclonal GLX1 antibody</p>

<p>Affinity purified Rabbit polyclonal MYO1B antibody</p>

CHMP5 antibody was raised in Rabbit using Human CHMP5 as the immunogen

A synthetic peptide for use as a blocking control in assays to test for specificity of TRH antibody, catalog no. 70R-10567

The Vitronectin antibody is a monoclonal antibody that specifically targets the growth factor Vitronectin. It has been shown to inhibit the activation of endothelial growth factor and protease activity. This antibody binds to specific target molecules on the surface of cells, preventing their interaction with other proteins and inhibiting their function. In addition, it has cytotoxic effects on certain cancer cells and can induce apoptosis, or programmed cell death. The Vitronectin antibody has also been found to bind to alpha-fetoprotein and necrosis factor-related apoptosis-inducing ligand, further highlighting its potential therapeutic applications in cancer treatment.

<p>Purified Polyclonal MRPS34 antibody</p>

The hCG antibody is a monoclonal antibody that specifically targets the human chorionic gonadotropin (hCG) hormone. It is commonly used in Life Sciences research and diagnostic applications. The hCG hormone is produced during pregnancy and is responsible for maintaining the corpus luteum, which produces progesterone to support the developing fetus. This antibody can be used to detect hCG in various biological samples, such as human serum or urine, and can be applied in immunoassays or other analytical techniques.

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections as it exhibits bactericidal activity. By binding to DNA-dependent RNA polymerase, this drug inhibits bacterial growth by preventing transcription and replication. Its potency has been demonstrated through a patch-clamp technique on human erythrocytes. The active form of this drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits their cell growth in culture.</p>

FAM120C antibody was raised in rabbit using the N terminal of FAM120C as the immunogen

<p>Rabbit polyclonal DGKD antibody</p>

<p>Ndrg2 antibody was raised in rabbit using the middle region of Ndrg2 as the immunogen</p>

<p>Rabbit anti-sheep IgG (biotin) was raised in rabbit using sheep IgG F(ab')2 fragment as the immunogen.</p>

DGKQ antibody was raised in Rabbit using Human DGKQ as the immunogen

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ZFP14 antibody, catalog no. 70R-8959</p>

<p>GBE1 antibody was raised in Rabbit using Human GBE1 as the immunogen</p>

<p>STX11 antibody was raised in rabbit using the C terminal of STX11 as the immunogen</p>

Purified recombinant Monkey IFN alpha 2 protein

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of FAM121B antibody, catalog no. 70R-1480</p>

Streptococcus pneumoniae antibody (FITC) was raised in rabbit using a whole cell blend of numerous serotypes as the immunogen.

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of HS3ST6 antibody, catalog no. 70R-2842</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SLCO3A1 antibody, catalog no. 70R-6586</p>

<p>Rabbit polyclonal NUP160 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of TMCC3 antibody, catalog no. 70R-6900</p>

The RIN1 antibody is a polyclonal antibody that targets the RIN1 protein. This protein plays a crucial role in various cellular processes, including cell adhesion and signaling. The RIN1 antibody specifically binds to the RIN1 protein, inhibiting its activity and preventing it from interacting with other proteins in the cell. This antibody has been shown to have neutralizing effects on the RIN1 protein, making it a valuable tool for researchers studying its function and potential therapeutic applications. The RIN1 antibody is widely used in life sciences research, particularly in studies involving alpha-fetoprotein, E-cadherin, colony-stimulating factors, interferons, and autoantibodies such as antiphospholipid antibodies. Its high specificity and affinity make it an excellent choice for various experimental techniques, including immunohistochemistry, Western blotting, and ELISA assays. With its exceptional performance and reliable results, the RIN1 antibody is an indispensable tool for

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of FECH antibody, catalog no. 70R-2623</p>

<p>ANO1 antibody was raised in Rabbit using Human ANO1 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of NSMCE1 antibody, catalog no. 70R-2769</p>

<p>The Calnexin antibody is a monoclonal antibody that specifically targets calnexin, a protein involved in protein folding and quality control in the endoplasmic reticulum. This antibody has been extensively studied and proven to be highly specific and sensitive in detecting calnexin expression in various tissues and cell types.</p>

21-147 amino acids: MGPTGTGESK CPLMVKVLDA VRGSPAINVA VHVFRKAADD TWEPFASGKT SESGELHGLT TEEEFVEGIY KVEIDTKSYW KALGISPFHE HAEVVFTAND SGPRRYTIAA LLSPYSYSTT AVVTNPKE

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of KIF3C antibody, catalog no. 70R-5613</p>

<p>PYGO1 antibody was raised in rabbit using the middle region of PYGO1 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of COMMD1 antibody, catalog no. 70R-10355</p>

FGFR1OP antibody was raised in Rabbit using Human FGFR1OP as the immunogen

<p>The GSTP1 antibody is a monoclonal antibody that specifically targets the glutathione S-transferase P1 (GSTP1) protein. This protein plays a crucial role in cellular detoxification processes and is involved in the metabolism of various drugs and toxins. The GSTP1 antibody has been extensively studied in the field of Life Sciences and has shown promising results in several areas.</p>

<p>Rabbit polyclonal ALPI antibody</p>

<p>B3GALT1 antibody was raised using the C terminal of B3GALT1 corresponding to a region with amino acids YKTSLHTRLLHLEDVYVGLCLRKLGIHPFQNSGFNHWKMAYSLCRYRRVI</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CA2 antibody, catalog no. 70R-9979</p>

<p>C10ORF132 antibody was raised using the N terminal Of C10Orf132 corresponding to a region with amino acids MATEVHNLQELRRSASLATKVFIQRDYSDGTICQFQTKFPPELDSRIERQ</p>

ZNF460 antibody was raised in rabbit using the N terminal of ZNF460 as the immunogen

Rabbit polyclonal Rab1A antibody (biotin)

A synthetic peptide for use as a blocking control in assays to test for specificity of SERPINA5 antibody, catalog no. 70R-5417

<p>THEG antibody was raised in rabbit using the middle region of THEG as the immunogen</p>

<p>Purified Polyclonal CUGBP1 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SPRY2 antibody, catalog no. 70R-8918</p>

<p>Rabbit polyclonal CASP1 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CKAP2 antibody, catalog no. 70R-10393</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of VPS37A antibody, catalog no. 70R-2831</p>

Mouse monoclonal ARFGAP1 antibody

Mouse monoclonal IgG2b Isotype Control Fc fusion protein (allophycocyanin)

<p>GNAS antibody was raised using the N terminal of GNAS corresponding to a region with amino acids SGKSTIVKQMRILHVNGFNGDSEKATKVQDIKNNLKEAIETIVAAMSNLV</p>

<p>ZRSR2 antibody was raised using a synthetic peptide corresponding to a region with amino acids HHDDYYSRLRGRRNPSPDHSYKRNGESERKSSRHRGKKSHKRTSKSRERH</p>

Metadherin antibody was raised in Mouse using a purified recombinant fragment of human MTDH expressed in E. coli as the immunogen.

A synthetic peptide for use as a blocking control in assays to test for specificity of HIST1H2AE antibody, catalog no. 70R-10218

<p>LRRC14 antibody was raised in rabbit using the C terminal of LRRC14 as the immunogen</p>

The Met antibody is a highly activated antibody that targets the hepatocyte growth factor receptor, also known as Met. It plays a crucial role in various cellular processes such as cell growth, survival, and migration. The Met antibody has been extensively studied for its potential therapeutic applications in cancer treatment.

HRP conjugated pure Human Albumin

<p>317-454 amino acids: MAANKRKNQN RNKSSSHQDS SRMSSVGDYN TSEQKQACKK HELYVSFRDL GWQDWIIAPE GYAAFYCDGE CSFPLNAHMN ATNHAIVQTL VHLMFPDHVP KPCCAPTKLN AISVLYFDDS SNVILKKYRN MVVRSCGCH</p>

<p>Rabbit polyclonal OR2A42 antibody</p>

<p>The ARG2 antibody is a highly specialized antibody that has a wide range of applications in the field of life sciences. It is commonly used in various assays and experiments to study the role of ARG2 in different biological processes.</p>

Rabbit polyclonal Transgelin antibody (HRP)

<p>Purified recombinant GCG protein</p>

<p>MLL antibody was raised in Mouse using a purified recombinant fragment of MLL(aa3751-3968) expressed in E. coli as the immunogen.</p>

Purified recombinant Human PYCR1 protein

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of VMD2L2 antibody, catalog no. 70R-1494</p>

<p>The Caspase 14 antibody is a specialized antibody that targets the kinase m2 enzyme. It is designed to detect and bind to specific cell antibodies, allowing for the identification and analysis of various cellular processes. This antibody has been extensively tested and validated using human serum samples, ensuring its reliability and accuracy in research applications.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PAIP2 antibody, catalog no. 70R-9375</p>

ROR1 antibody was raised in Mouse using recombinant extracellular fragment of human ROR1 (aa30-406) fused with hIgGFc tag, expressed in HEK293 cells as the immunogen.

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ATP8B2 antibody, catalog no. 70R-4519</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections and contains active compounds that exhibit bactericidal activity. By binding to DNA-dependent RNA polymerase, this drug inhibits bacterial growth, preventing transcription and replication. Its potency has been demonstrated using a patch-clamp technique on human erythrocytes. The active form of this drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed in Mycobacterium tuberculosis strains and inhibits cell growth in culture.</p>

EZH2 antibody was raised in Rabbit using Human EZH2 as the immunogen

Purified Polyclonal BCLAF1 antibody

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of RASGRF1 antibody, catalog no. 70R-9407</p>

<p>Purified recombinant Human BCL2A1 Protein (His tag)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of TNNT3 antibody, catalog no. 70R-1233</p>

<p>Recombinant human SHMT1 protein (His tag)</p>

<p>The FOXP2 antibody is a highly specialized microparticle used in Life Sciences research. It is a polyclonal antibody that specifically targets the FOXP2 protein, which plays a crucial role in various cellular processes. This antibody can be used in applications such as transcription-polymerase chain reaction (PCR), interferon assays, and antigen-antibody reactions.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SLC15A4 antibody, catalog no. 70R-6547</p>

<p>COQ9 antibody was raised in Rabbit using Human COQ9 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of NOSIP antibody, catalog no. 70R-2310</p>

A synthetic peptide for use as a blocking control in assays to test for specificity of ALDOC antibody, catalog no. 70R-2334

CD80 antibody was raised in Mouse using a purified recombinant fragment of CD80 expressed in E. coli as the immunogen.

Claudin 9 antibody was raised using the C terminal of CLDN9 corresponding to a region with amino acids WAAAALLMLGGGLLCCTCPPPQVERPRGPRLGYSIPSRSGASGLDKRDYV

<p>ARHGAP18 antibody was raised in Rabbit using Human ARHGAP18 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of GALNT5 antibody, catalog no. 70R-7239</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SERPINB5 antibody, catalog no. 70R-1273</p>

Rabbit polyclonal ETS1 antibody (Thr38)

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SFRS2B antibody, catalog no. 70R-4662</p>

Region of Betacellulin protein corresponding to amino acids DGNSTRSPET NGLLCGDPEE NCAATTTQSK RKGHFSRCPK QYKHYCIKGR CRFVVAEQTP SCVCDEGYIG ARCERVDLFY.

<p>The Cortactin antibody is a highly specialized product in the field of Life Sciences. It is an acidic growth factor that plays a crucial role in cellular processes such as cell migration, adhesion, and invasion. This Polyclonal Antibody specifically targets the activated form of Cortactin and can be used for various applications including immunoassays, western blotting, and immunofluorescence.</p>

<p>The beta Catenin antibody is a powerful tool used in Life Sciences research. It specifically targets the nuclear β-catenin and forms an antibody complex, allowing for the detection and analysis of this important protein. The beta Catenin antibody can be used in various applications such as transcription-polymerase chain reaction (PCR), bioassays, immunoassays, and more. Its high specificity and sensitivity make it an ideal choice for studying the role of β-catenin in cellular processes, including pluripotent stem cell differentiation and development. This antibody is available in both polyclonal and monoclonal forms to suit different experimental needs. With its ability to detect surface glycoproteins and cox-2 inhibitors, the beta Catenin antibody is an essential tool for researchers looking to gain insights into cellular signaling pathways and molecular interactions.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of Trim3 antibody, catalog no. 70R-9562</p>

<p>The VDAC1 antibody is a specific monoclonal antibody that is used as a molecular drug in the field of Life Sciences. It has been extensively studied for its ability to target and neutralize antiphospholipid antibodies, which are known to have procoagulant and anticoagulant effects. The VDAC1 antibody has also been shown to inhibit protein kinase activity and regulate fatty acid metabolism. It is commonly used in research studies involving insulin signaling pathways and the modulation of cellular processes. Additionally, this antibody has been investigated for its potential therapeutic applications in various fields, including the treatment of mesenchymal stem cells and the development of novel oral contraceptives. Its high specificity and effectiveness make it a valuable tool for researchers in the Life Sciences field.</p>

PSMD3 antibody was raised using a synthetic peptide corresponding to a region with amino acids RLNHYVLYKAVQGFFTSNNATRDFLLPFLEEPMDTEADLQFRPRTGKAAS

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of MAP2K2 antibody, catalog no. 70R-2007</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CPXCR1 antibody, catalog no. 20R-1231</p>

<p>DARS antibody was raised in Rabbit using Human DARS as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of IGSF8 antibody, catalog no. 70R-9919</p>

<p>Rabbit polyclonal APIP antibody</p>

Purified Avidin protein (Texas Red) from hen egg white

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of JAK3 antibody, catalog no. 70R-5747</p>

<p>Sheep polyclonal DNM1 antibody (Ser778)</p>

<p>Mouse monoclonal TCP11L2 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ALX3 antibody, catalog no. 20R-1182</p>

<p>The NME1 protein is an antigen that belongs to the group of Recombinant Proteins &amp; Antigens. It contains specific epitopes that can be recognized by antibodies in human serum. This protein has a suppressive effect on viral replication and is considered to have antiviral properties. It is composed of a sequence of amino acid residues that are important for its biological activity. The NME1 protein can be used in various applications in the Life Sciences field, such as research studies and diagnostic assays. Its specific antibody can be detected using techniques like matrix-assisted laser desorption/ionization (MALDI) or lysosomal acid residues analysis.</p>

Purified Goat IgG (Fc) HRP conjugate

CDC42EP3 antibody was raised in Rabbit using Human CDC42EP3 as the immunogen

<p>The NCOR1 antibody is a highly specialized product in the field of Life Sciences. It is a colloidal solution that targets insulin and growth factor receptors. This polyclonal antibody has been extensively tested and proven to effectively bind to tyrosinase, alkaline phosphatases, epidermal growth factor, and anti-ACTH antibodies. With its high specificity and affinity for these targets, the NCOR1 antibody plays a crucial role in various research applications involving insulin signaling pathways and hormone regulation. Whether you are studying the effects of insulin on cell growth or investigating novel therapeutic approaches for diabetes, this Antibody is an essential tool for your experiments. Trust in its reliability and accuracy to deliver consistent results every time.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ACSL4 antibody, catalog no. 70R-7155</p>

<p>Rabbit anti-mouse IgM (biotin) was raised in rabbit using murine IgM mu heavy chain as the immunogen.</p>

The p27Kip1 antibody is a highly specific and potent neutralizing antibody that targets the p27Kip1 protein. This protein plays a crucial role in cell cycle regulation and acts as a tumor suppressor. The p27Kip1 antibody has been extensively studied in the field of Life Sciences and has shown great potential as a therapeutic tool for cancer treatment.

<p>Purified recombinant Human VASP protein</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SNX5 antibody, catalog no. 70R-5748</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of VIP antibody, catalog no. 70R-6661</p>