Biochemicals and Reagents

<p>Methadone antibody was raised in mouse using methadone-BSA as the immunogen.</p>

<p>Goat anti-monkey IgM (HRP) was raised in goat using monkey IgM as the immunogen.</p>

<p>IL8 antibody was raised in mouse using recombinant human IL8 as the immunogen.</p>

<p>Calcitonin antibody was raised in mouse using calcitonin conjugated with carrier protein as the immunogen.</p>

<p>Influenza A antibody was raised in mouse using Influenza A as the immunogen.</p>

<p>Purified recombinant EBV p138 protein (His tag)</p>

<p>Parvovirus antibody was raised in mouse using canine parvovirus as the immunogen.</p>

<p>Peptide Ac-FQRKTLQRRNLKGLNLNL-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>HIV1 gp41 antibody was raised in mouse using HIV-1 transmembrane protein gp41 as the immunogen.</p>

<p>Conjugated Thyroxine protein (BSA) hapten</p>

<p>ADCY8 antibody was raised in Rabbit using Human ADCY8 as the immunogen</p>

<p>HCV NS3 genotype 1a immunodominant regions of Hepatitis C Virus protein containing amino acids 1192-1459.</p>

<p>Parainfluenza type 1 antibody was raised in mouse using parainfluenza virus, type 1 as the immunogen.</p>

<p>Transferrin antibody was raised in mouse using placental transferrin receptor or transferrin as the immunogen.</p>

<p>Purified recombinant HSV1 gG1M protein</p>

<p>PSA antibody was raised in mouse using human seminal fluid PSA as the immunogen.</p>

<p>CKMM antibody was raised in goat using highly purified human CK-MM isoenzyme as the immunogen.</p>

<p>Leucocyte elastase antibody was raised in rabbit using human leucocyte elastase as the immunogen.</p>

<p>Region of GM-CSF protein corresponding to amino acids MAPTRSPITV TRPWKHVEAI KEALNLLDDM PVTLNEEVEV VSNEFSFKKL TCVQTRLKIF EQGLRGNFTK LKGALNMTAS YYQTYCPPTP ETDCETQVTT YADFIDSLKT FLTDIPFECK KPVQK.</p>

<p>Purified Bovine IgG (Fc) FITC conjugate</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Hemoglobin antibody was raised in mouse using human hemoglobin as the immunogen.</p>

<p>Purified Goat IgG FITC conjugate</p>

<p>The Endothelin 1 antibody is a monoclonal antibody that has cytotoxic properties. It is designed to specifically target and bind to Endothelin 1, a protein involved in various cellular processes. This antibody can be used for transfer reactions, such as immunoprecipitation or Western blotting, to detect the presence of Endothelin 1 in biological samples. The antibody is produced by hybridoma cells and purified using cellulose chromatography. It forms an antibody-antigen complex with Endothelin 1, allowing for its detection and quantification. The Endothelin 1 antibody is highly specific and does not cross-react with other protein isoforms or interfere with other cellular processes. It can be used in various life science research applications, including the study of signaling pathways involving the 5-HT1A serotonin receptor. Additionally, this antibody can be conjugated with enzymes such as phosphatase for further detection methods.</p>

<p>Osteocalcin protein is a crucial component in the field of Life Sciences. It is widely used for immobilization studies, particularly in the context of sorafenib research. This protein can be effectively immobilized on an electrode surface and utilized for various applications such as mineralization studies, neutralizing assays, and immunoassays. Osteocalcin protein is often employed as a target molecule for monoclonal antibody development and detection in human serum samples. Additionally, it plays a significant role in studying the differentiation of mesenchymal stem cells into adipose tissue. Furthermore, this protein has been shown to exhibit phosphatase activity and can be used as an inhibitor in relevant experiments. With its versatility and importance in multiple research areas, Osteocalcin protein serves as a valuable tool for scientists and researchers alike.</p>

<p>Purified recombinant p47 Treponema Pallidum protein</p>

<p>Trypsin is a protease that hydrolyses proteins by cleaving the peptide bond at the carboxyl side of the positively charged amino acid (Lysine or Arginine). Trypsin belongs to a family of serine proteases, as it has a serine in its active site. Trypsin can be inhibited by using trypsin inhibitor Alpha 1 Antitrypsin.</p>

<p>Histone Core antibody was raised in sheep using Intact calf Histone core complex to rRNA as the immunogen.</p>

<p>Goat anti-human IgG (FITC) was raised in goat using human IgG F(ab')2 fragment as the immunogen.</p>

<p>HA antibody was raised in mouse using YPYDVPDYA synthetic peptide conjugated to KLH as the immunogen.</p>

<p>Conjugated Phenobarbital-Alk Phos hapten</p>

<p>Apo (a) antibody was raised in goat using human apolipoprotein (a) as the immunogen.</p>

<p>Cytokeratin 2e antibody was raised in mouse using a synthetic peptide (N-terminal amino acids 2-23) of human cytokeratin 2e as the immunogen.</p>

<p>Insulin antibody is a monoclonal antibody that has inhibitory properties against insulin. It acts by binding to insulin and preventing its activation, thereby inhibiting its function in the body. This antibody has been shown to have inhibitory effects on various processes, including nuclear signaling pathways, chemokine production, interferon release, collagen synthesis, and the production of autoantibodies. Additionally, insulin antibody has been found to inhibit the activity of TGF-β1, a cytokine involved in cell growth and immune responses. In the field of Life Sciences, this antibody is commonly used in research studies involving insulin-related pathways and metabolism. It has also been utilized in liver microsome studies to investigate drug interactions and metabolic processes.</p>

<p>The alpha Actin antibody is a monoclonal antibody that specifically targets and binds to alpha actin, a protein involved in muscle contraction. This antibody has various characteristics and applications in the field of Life Sciences. It can be used for research purposes to study the role of alpha actin in different biological processes. One of the key characteristics of this antibody is its cytotoxic activity. It has been shown to have a potent cytotoxic effect on human hepatocytes, inhibiting their growth and inducing cell death. This makes it a valuable tool for studying the mechanisms underlying liver diseases and potential therapeutic interventions. Additionally, the alpha Actin antibody has been found to have anti-vascular endothelial growth factor (anti-VEGF) properties. VEGF is a protein that promotes the formation of new blood vessels, and its overexpression is associated with various diseases, including cancer. By blocking VEGF activity, this antibody may help inhibit angiogenesis and tumor growth. Furthermore, this monoclonal antibody has</p>

<p>Anti-Feline Leukemia Virus antibody</p>

<p>Chikungunya virus antibody is a highly effective solution for combating the Chikungunya virus. This antibody specifically targets and neutralizes the virus, preventing its replication and spread within the body. It works by binding to collagen, which is present on the surface of infected cells, effectively blocking the virus from entering healthy cells.</p>

<p>Rabbit polyclonal Ergocryptine antibody</p>

<p>Peptide H-LLGASVLGL^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Streptococcus Group B antibody was raised in mouse using Group B Streptococcus as the immunogen.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of AHSG antibody, catalog no. 70R-5916</p>

<p>TGF alpha antibody was raised in mouse using 17-amino acid synthetic peptide from carboxyl-terminus of rat TGF-alpha as the immunogen.</p>

<p>Pro-Collagen I antibody was raised in mouse using human procollagen I as the immunogen.</p>

<p>6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an antituberculosis drug that falls under the category of rifamycins. It is highly effective in treating tuberculosis infections and contains active compounds with bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, preventing transcription and replication, thus inhibiting bacterial growth. Extensive research has demonstrated its high efficacy using advanced techniques such as the patch-clamp technique on human erythrocytes. In addition, this drug undergoes various metabolic transformations including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Furthermore, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits cell growth in culture.</p>

<p>NKX2-5 antibody was raised in Rabbit using Human NKX2-5 as the immunogen</p>

<p>IL1 beta antibody was raised using the N terminal of IL1B corresponding to a region with amino acids DLDLCPLDGGIQLRISDHHYSKGFRQAASVVVAMDKLRKMLVPCPQTFQE</p>

<p>CEA antibody (HRP) was raised in goat using affinity pure human CEA as the immunogen.</p>

<p>Myoglobin antibody was raised in mouse using human cardiac myoglobin as the immunogen.</p>

<p>Aflatoxin B antibody was raised in Mouse using Raised against aflatoxin of Aspergillus flavus origin as the immunogen.</p>

<p>6-Fluoro-3-indoxyl-beta-D-galactopyranoside: Experience the power of 6-Fluoro-3-indoxyl-beta-D-galactopyranoside, a potent antituberculosis drug from the rifamycin class. Designed to combat tuberculosis infection, this active compound exhibits remarkable bactericidal activity. By binding to DNA-dependent RNA polymerase, it inhibits bacterial growth by preventing transcription and replication. Tested using advanced techniques like the patch-clamp technique on human erythrocytes, this drug has shown high efficacy in treating tuberculosis. Metabolized through various transformations including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid, it offers comprehensive treatment against Mycobacterium strains. Don't let tuberculosis hold you back - choose 6-Fluoro-3-indoxyl</p>