Biochemicals and Reagents

<p>H-Gln(Trt)-2-ClTrt-Resin (100-200 mesh) 1% DVB is a resin for the synthesis of peptides. It is a building block that can be used to synthesize peptides. H-Gln(Trt)-2-ClTrt-Resin (100-200 mesh) 1% DVB is an alcohols, amines, and thiols resin that can be used to synthesize peptides. H-Gln(Trt)-2-ClTrt-Resin (100-200 mesh) 1% DVB has been shown to react with thiols, alcohols and amines, which are building blocks for peptide synthesis.</p>

<p>Substrate of the epidermal growth factor receptor (EGFR), a member of the receptor tyrosine kinase family known as ErbBs or HER receptors. These receptors are involved in the regulation of cell proliferation, survival, differentiation and migration. However their dysregulation can contribute towards many diseases such as cancer.Binding to the ligand binding domain of the EGFR causes receptor dimerization. This is sequentially followed by the tyrosine kinase domain being activated and the tyrosines on the C-terminal tail become phosphorylated, which in turn activates downstream signalling pathways.</p>

<p>Blocks the Wnt pathway and inhibits the expression of TGFb1 in CT26 colon carcinoma cells, leading to the reduction of CCL20 and CCL22, two TGF-b- dependent chemokines critical for Treg cell recruitment into the tumour microenvironment.  hsBCL9CT-24 shows robust antitumour efficacy across multiple in vivo models.</p>

<p>Protein kinases are important drug targets for numerous diseases to try and better evaluate the enzyme specificity, affinity, mode of action and identify possible inhibitors. In vitro assays and synthetic substrates provide valuable data about human kinase activity. CREBtide KRREILSRRPSYR is based on the phosphorylation sequence in d-CREB (cAMP response element binding protein) it is a substrate for protein kinase A (PKA)(Km = 3.9 mM). However, it has also been tested as a substrate for other protein kinases, including cAMP-dependent protein kinase (cAK) and protein kinase C (PKC). Immunoblots and autoradiography have been used for CREBtide KRREILSRRPSYR in vitro kinase analysis.</p>

<p>This C-terminal Sortagging peptide acts as a (oligo)glycine nucleophile in the final steps of a sortagging protein labelling reaction. This reaction results in the (Sulfocyanine7) fluorescent moiety being attached to the C-terminus of the target protein or peptide.A substrate peptide containing the LPXTG motif is recognised and cleaved by the enzyme Sortase A (SrtA) from Staphylococcus aureus. The catalytic cysteine residue in the active site of SrtA, serves as a nucleophile to cleave the peptide bond between threonine and glycine of the substrate peptide. Cleavage results in the formation of a thioacyl intermediate between the substrate peptide and SrtA. This intermediate is then resolved by the N-terminus of this (oligo)glycine nucleophile peptide, resulting in the creation of a new peptide bond that links the substrate peptide to this peptide and its fluorescent dye.  This method of protein labelling is known as sortagging.This peptide contains Sulfocyanine7, which is a NIR (near infrared) emitting fluorescent dye.</p>

<p>The full Rev is vital in aiding transport of unspliced viral mRNA from the nucleus. Within Rev there are 3 main functional regions - the arginine rich motif (ARM), the oligomerization domain (OD), and nuclear export sequence (NES). The peptide sequence 34-50 aligns to the ARM motif which binds the Rev Response Element (RRE) in RNA to form a complex which ultimately leads to nuclear export. ARM is able to recognise a wide range of RNA sequence to and still bind to form a Rev dimer. The Rev ARM sequence has also been shown to work as a nuclear localisation sequence that can penetrate cells. In research, Rev ARM has been utilised as a cell penetrating peptide (CPP) for its ability to bind RNA due to the arginine residues presenting multiple sides for binding and thus deliver macromolecules into the cell.</p>

<p>Cathepsin D is an aspartic endo-protease that is ubiquitously distributed in lysosomes. The main function of cathepsin D is to degrade proteins and activate precursors of bioactive proteins in pre-lysosomal compartments, including substrates of endocytosis, phagocytosis and autophagy. Consequently, cathespin D deficiency leads to a strong impairment of the lysosomal-autophagy machinery.Mutations in the gene encoding cathespin D, CTSD, are associated with the pathogenesis of several diseases, including breast cancer and Alzheimer disease.</p>

<p>Mouse IgG2b heavy chain antibody was raised in rat using murine IgG as the immunogen.</p>

<p>IRBP (1-20) is derived from the interphotoreceptor retinoid-binding protein (IRBP), present in the interphotoreceptor matrix and is expressed by cone and rod photoreceptors in the eye. IRBP is involved in retinoid delivery and protects retinal cells from oxidative stress.In retinitis pigmentosa patients, IRBP can be subjected to mutations resulting in a non-secreted form of IRBP to be produced. Furthermore IRBP gene mutations have been associated with high myopia and retinal dystrophy.The expression of IRBP is reduced in diabetes patients which may lead to visual cycle misfunction and the photoreceptors can be vulnerable to damage.</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is specifically designed to combat tuberculosis infections by targeting the active compounds responsible for bactericidal activity. By binding to DNA-dependent RNA polymerase, this drug effectively inhibits bacterial growth, preventing transcription and replication. Additionally, it has been proven to exhibit high efficacy against Mycobacterium tuberculosis strains. The metabolism of this drug involves various transformations, including hydrolysis, oxidation, reduction, and conjugation. With its exceptional properties and targeted approach, the 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an invaluable weapon in the fight against tuberculosis.</p>

<p>Purified native Human TSH protein (&gt; 98% pure)</p>

<p>Part of the angiopep family of peptides which have been derived from the Kunitz domain of human aprotinin. These peptides are able to cross the blood brain barrier (BBB) and have been used to facilitate the delivery of pharmacological agents to the brain, for example to target glioblastoma tumours and recurrent brain metastases of pre-treated breast cancers. Angiopep-2 has higher transcytosis capacity and higher brain volume of distribution than aprotinin. Like aprotinin, angiopep-2 interacts with low-density lipoprotein receptor-related protein 1 (LRP1) which is thought to promote its delivery across the BBB via receptor-mediated transcytosis (RMT). However the interaction with LRP1 may not be the only method for angiopep-2 to cross into the brain.</p>

<p>Dipeptidyl peptidase 4 (DPP4) inhibitor</p>

<p>Albumin (556-564) Bovine is derived from the globular protein Albumin and is found in the blood plasma of humans (known as Human Serum Albumin, HSA) where it serves to maintain plasma pressure and nutritional balance. Another role it carries out is the transportation of bound molecules through the blood. Bovine serum albumin (BSA), composed of 583 amino acids, is very similar to HSA thus allowing BSA to be used as a successful model and a standard protein in laboratory experiments.Although BSA and HAS share homology in their three domains, I, II and III, BSA contains 2 tryptophan whereas HAS only contains 1 tryptophan residue.In agriculture the presence of the albumin protein has been used to assess the health of cows to ensure that a suitable quality of milk and meat are produced. Moreover it is important to detect bovine albumin in food and pharmaceutical products due to it being an allergenic protein.</p>

<p>Analeptic</p>

<p>Inhibits lysophosphatidylserine hydrolysis by the integral membrane serine hydrolase ABHD12 (IC50 = 1.3 µM). Raised levels of lysophosphatidylserine were observed in mouse brain in vivo and in primary human macrophages. DO 264 had proinflammatory effects, following infection with lymphocytic choriomeningitis virus (LCV) clone 13 in mice, resulting in severe inflammatory lung damage.</p>

<p>Angiotensin II (Ang-II) is a key signalling peptide of the renin angiotensin system (RAS) which is  involved in regulating functions such as blood pressure, cardiovascular function and energy balance. RAS activity is elevated in obesity and is widely studied in relation to lifestyle-related diseases.Ang-II is produced from angiotensinogen (AGT) via the intermediate angiotensin I (Ang-I). AGTis cleaved by the aspartyl-protease, renin, to produce Ang-I, which is then cleaved by the dicarboxyl-peptidase angiotensin converting enzyme (ACE), which removes a histidine and a leucine, from the C-terminus of Ang-I to form Ang-II.Ang-II exerts its affect by binding to the G-protein-coupled receptors- Ang II type 1 (AT1) and Ang II type 2 (AT2) receptors. Ang-II plays central roles in glucose metabolism and blood pressure. Increased levels of Ang-II have also been associated with Alzheimer's disease, and certain cancers including oesophageal squamous cell carcinoma (ESCC), brain cancers and breast cancer. The effects of Ang-II appear to be supressed or limited by another branch of the RAS- the ACE2/Ang-(1-7)/Mas pathway.The isoleucine residue at position 5 of this peptide is isotopically labelled with carbon-13 (6) and nitrogen-15 (1), giving this peptide a mass increase of 7 compared to the unlabelled peptide.</p>

<p>Membrane-active peptide that binds to HDM-2 expressed in the membranes of solid tissue tumour cells to induce transmembrane pore formation in cancerous, but not normal cells, resulting in tumour cell necrosis independent of p53 activity.</p>

<p>The HBsAg antibody is a low-density monoclonal antibody that is used in Life Sciences for various applications. This antibody specifically targets and binds to the hepatitis B surface antigen (HBsAg), which is a key marker of hepatitis B infection. By binding to HBsAg, this antibody can be used in assays to detect and quantify the presence of the virus in patient samples. In addition to its diagnostic applications, the HBsAg antibody has also been studied for its potential therapeutic uses. It has been shown to have an inhibitory effect on adiponectin, a hormone involved in regulating glucose metabolism and fatty acid oxidation. Furthermore, studies have demonstrated that this antibody can modulate the activity of activated androgen receptors, which play a role in various physiological processes. Moreover, the HBsAg antibody has been explored as a potential medicament for autoimmune disorders. Autoantibodies, which are antibodies produced by the immune system against self-antigens, can contribute to the development of</p>

<p>The 14 amino acid fragment of myelin basic protein (MBP) (68-82) can induce experimental allergic encephalomyelitis (EAE) in Lewis rats. EAE is the most used experimental model for studying the human inflammatory demyelinating diseases, such as multiple sclerosis (MS).MBP is an integral component of myelin found in the central nervous system (CNS). MBP is considered vital for the development and stability of the myelin sheath where it plays a role in membrane adhesion. MPBs constitute an extraordinarily varied collection of splice isoforms which show a myriad of post-translational modifications. MBP may be targeted by auto-antibodies in diseases such as MS. Use of MBP fragments in immunology assays are helping to answer this. The low affinity of MBP (1-9) peptide for major histocompatibility complex (MHC) class II molecules may result in MBP autoreactive T cells escaping central-tolerance, where self-reactive T cells are usually eliminated. The activity induced by MBP (68-82) suggests it can cause EAE but other EAE MBP peptides were found to induce a stronger response. The MBP (68-82) and others available in our catalogue may help to understand the nature of demyelinating diseases and find the target autoantigens of conditions such as MS.</p>

<p>ERKtide Substrate Peptide.</p>

<p>Amino acids 1-14 of β-amyloid peptide (Aβ).Aβ has been identified as the key subunit of the extracellular plaques found in the brains of patients with Alzheimer's disease (AD) and Down's syndrome (DS). Aβ has therefore been extensively studied as a potential target for treatment of AD. Aβ is formed from the cleavage of the large, transmembrane protein- APP (amyloid precursor protein). Cleavage of APP by β- and then γ-secretases results in the formation of Aβ. Aβ can aggregate to produce amyloid-β oligomers, which are thought to be highly neurotoxic. Over time Aβ can further aggregate to produce the characteristic senile plaques present in AD and DS. Aβ can be degraded by enzymes such as neprilysin, insulin degrading enzyme or endothelin converting enzyme. At physiological levels Aβ may be involved in controlling synaptic activity and neuronal survival.Contains a C-terminal biotin tag for easy detection and purification.</p>

<p>Natalizumab LC46-58 KSN deimmunised</p>

<p>Dyrk1a antibody was raised in rabbit using the N terminal of Dyrk1a as the immunogen</p>

<p>LL-37 is a member of the large cationic family of anti-microbial peptides called cathelicidins which have broad-spectrum anti-microbial activity and are expressed in many species. The only cathelicidin found in humans is LL-37, this is produced in epithelial cells, by proteolytic cleavage from the C-terminal of the hCAP-18 protein. LL-37 can be processed into different forms of anti-microbial peptides. As well as its anti-microbial properties LL-37 also regulates many aspects of the innate immune system and overexpression of LL-37 has been linked to autoimmune diseases such as asthma and psoriasis, making LL-37 the most studied form of the human cathelicidin peptides.More recently, studies have shown that LL-37 binds to SARS-CoV-2 S protein and inhibits binding to its receptor hACE2, which may inhibit viral entry into the cell. LL-37 is upregulated by vitamin D, therefore this may be one mode of action for the positive outcomes seen with vitamin D treatment for Covid-19.</p>

<p>Purified native Trypanosoma cruzi Chagas protein</p>

<p>Peptide H-GCSFLPDPYQK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Histone H3 (1-20) with a C-terminal tryptophan (W) is derived from Histone 3 (H3) which is one of the four core histones (H2A, H2B, H3 and H4) fundamental in compacting eukaryotic DNA into a structure known as the nucleosome. The nucleosome arises when 147 base pairs of DNA wrap around a H3-H4 tetramer and two H2A-H2B dimers, forming the histone octamer core. Both H4 and H3 are highly conserved and perform roles in binding to segments of DNA which enter and leave the nucleosome and in chromatin formation. Similar to the other core histone, H3 has a globular domain and a flexible N-terminal domain, 'histone tail' which can undergo modifications such as acetylation, methylation, phosphorylation and ubiquitination. Due to histones containing a large number of lysine and arginine residues they have a positive net charge which interacts in an electrostatic manner with the negatively charged phosphate groups in DNA. The transcriptional activation or silencing of the chromatin is controlled by ATP-dependent chromatin remodelling factors and histone modifying enzymes which target histone proteins. Both processes function to alter the positioning of the nucleosome, allowing the DNA it to be either available or inaccessible to the transcription machinery.</p>

<p>Ghrelin is an orexigenic peptide hormone mainly produced in the stomach as precursor preproghrelin. Cleavage of preproghrelin followed by modification leads to the formation of ghrelin with the addition of a fatty acid to its serine 3 residue- ghrelin is capable of activating the growth hormone release receptor (GHSR). Ghrelin is involved in appetite stimulation and growth hormone release.Most circulating ghrelin is in the non-acylated form (des-octanoyl) ghrelin. (Des-octanoyl)-ghrelin has some distinct functions from ghrelin, the lack of acylation prevents binding to the ghrelin receptor and growth hormone release. However, (des-octanoyl) ghrelin has negative inotropic effects on papillary muscle and cardioprotective function. There is evidence (des-octanoyl) ghrelin inhibits proliferation of certain cancer cell lines, while promoting adipogenesis has been observed in other experiments in vivo.</p>

<p>Desmoglein 2 antibody was raised using the N terminal of DSG2 corresponding to a region with amino acids KIHSDLAEERGLKITYKYTGKGITEPPFGIFVFNKDTGELNVTSILDREE</p>

<p>Histone H3 (1-8) is derived from Histone 3 (H3) which is one of the four core histones (H2A, H2B, H3 and H4) fundamental in compacting eukaryotic DNA into the nucleosome. The nucleosome arises when 147 base pairs of DNA wrap around a H3-H4 tetramer and two H2A-H2B dimers, forming the histone octamer core. Both H4 and H3 are highly conserved and perform roles in binding to segments of DNA which enter and leave the nucleosome and in chromatin formation. Similar to the other core histone, H3 has a globular domain and a flexible N-terminal domain 'histone tail' which can undergo modifications such as acetylation, methylation, phosphorylation and ubiquitination. Due to histones containing a large number of lysine and arginine residues they have a positive net charge which interacts in an electrostatic manner with the negatively charged phosphate groups in DNA. The transcriptional activation or silencing of the chromatin is controlled by ATP-dependent chromatin remodelling factors and histone modifying enzymes which target histone proteins. Both processes function to alter the positioning of the nucleosome, allowing the DNA it to be either available or inaccessible to the transcription machinery.</p>

<p>Amino acids 169-178 of microtubule-associated protein 1A (MAP1A) light chain. MAP1A is expressed from the Map1a gene which encodes a precursor polypeptide which is cleaved to produce MAP1A heavy chain and light chain.MAP1A is a structural protein essential for the organisation of neuronal microtubules (MTs) and is abundantly expressed in the mammalian brain. MAP1A is thought to help maintain the neuronal MT network, and modulate synaptic proteins and neuronal survival in the adult central nervous system (CNS). When MAP1A is disrupted in the body it results in problems in coordination, tremors, and late-onset degeneration of cerebellar Purkinje cells.</p>

<p>Acetylated α-synuclein (1-13) is derived from the alpha-synuclein intrinsically disordered protein which is found in the neurons and presynaptic terminals. Encoded by the SNCA1/PARK1 gene alpha-synclein is structurally composed of 140 amino acids, making up the three domains: N-terminal membrane binding domain, a hydrophobic non-amyloid-β component domain and a hydrophilic C-terminal domain. Usually alpha-synuclein plays a role in protecting neurons from apoptotic stimuli and is involved in synaptic vesical trafficking.However it has been found that the accumulation of alpha-synuclein aggregates can lead to neurodegenerative diseases such as Parkinson disease, dementia with Lewy bodies and multiple system atrophy. It is further involved in the fibrilisation of amyloid-b and tau which play a major role in Alzheimer disease. Amyloid fibrils are formed from alpha synuclein monomers within the cytosol and when bound to membranes these monomers can undergo conformational changes to form protofibrils and then ring like oligomers. This can result in the formation of transmembrane pores which disrupts the membrane, calcium homeostasis and signalling.Alpha-synuclein can be subjected to the post-translational modifications of phosphorylation and N-terminal acetylation. When acetylation occurs at the N-terminus of an alpha-synuclein monomer, the intramolecular hydrogen bonds are altered thus reducing the rate of alpha-synuclein aggregation and the strength at which it interacts with the membrane is increased.The leucine residue at position 8 is isotopically labelled with carbon-13(6) and nitrogen-15(1).</p>

<p>Peptide H-ALEQDLPVNIK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-SYKV-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>The SARS-CoV-2 non-structural protein 13 (NSP13) has been identified as a target for anti-viral therapeutics due to its highly conserved sequence and is essential for viral replication.  NSP13 is part of the helicase superfamily 1B. As an NTPase and RNA helicase, NSP13 binds to RNA-dependent RNA polymerase and acts in concert with the replication-transcription complex to stimulate backtracking and further activate NSP13 helicase activity. These factors make NSP13 a good target for developing new antiviral drugs. In addition, the identification of epitopes within the NSP13 sequence can help design more effective SARS-CoV-2 vaccines.Models have predicted epitopes exhibiting antigenicity, stability and interactions with MHC class-I and class-II molecules. NSP13 (236-250) is an epitope candidate with various predicted HLA restrictions. This epitope can be used to better vaccine design for more durable CD4+ and CD8+ T cell responses for long-lasting immunity.</p>

<p>Bcl-2-modifying factor (Bmf) belongs to the BH3-only class of Bcl-2 family proteins (along with Bim). Bmf has pro-apoptotic activity and can trigger mitochondrial apoptosis via inhibition of CAP-dependent protein synthesis, it is also involved in B cell development and anoikis. Bmf activity is regulated by dynein light chain (DYNLL) 1 and 2, via inducing its homo-dimerization and leading to the formation of ternary complexes (such as Bim-DYNLL-Bmf).</p>

<p>Insulin receptor (IR) substrate 1 (IRS-1) peptide is a highly selective substrate for certain kinase sub-families- such as receptor tyrosine kinases (which includes IR). IRS-1 is also a very good substrate for the cytoplasmic kinases JAK-1, 2, and 3.IRS-1 is a large ubiquitously expressed protein, vital for propagating insulin action. IRS-1 is activated by phosphorylation of multiple tyrosine residues via an activated IR. Activated IRS-1 then acts as a docking site for downstream signalling proteins which contain a Src homology 2 (SH2) domain (such as phosphatidylinositol 3-kinase (PI3K), growth factor receptor-bound protein 2 (Grb2), and SHP-2). In addition to its role in metabolic signalling, IRS-1 also propagates proliferative and anti-apoptotic signals and is overexpressed in most cancers.</p>

<p>With the rise of multidrug-resistant bacteria like P. aeruginosa, the hunt for low toxicity inhibitors is paramount. A crucial part of their virulence/life cycle is cleavage of signal peptides. Type I signal peptides have a C-terminal hydrophilic domain containing a signal peptidase cleavage site commonly found in P. aeruginosa proteins that are cleaved by type I signal petidases (SPases). P. aeruginosa LasB, a type I signal peptide, is a crucial enzyme for bacterial invasion, it degrades elastin and thus aids tissue invasion, without cleavage by a SPase the protein is inactive. This peptide is an ideal candidate for enzymatic assay work in to SPase inhibitor investigations.Here we provide the substrate LasB sequence with the EDANS-Dabcyl donor quencher pair suitable for SPase inhibitor assays with FRET microscopy analysis. When this peptide is intact, fluorescence from the fluorophore (donor) EDAN is undetectable due to the proximity of the acceptor (quencher) Dabcyl. However, upon cleavage the fluorescence of the EDANS moiety, as measurably by excitation/emission 340/490nm, can be detected due to separation from the Dabcyl quencher.</p>

<p>The heptapeptide Alexamorelin is a member of the Growth Hormone secretagogues (GHS) family. These are synthetic molecules which act through the central nervous system to stimulate the secretion of somatotrophs, prolactin, adrenocorticotrophin and cortisol. Alexamorelin has also been shown to inhibit 125I-Tyr-Ala-HEX binding in tissues. Due to their stimulation of growth hormone release, they are known as non-approved pharmaceuticals and are a concern to sport's drug testing organisations.</p>

<p>Melittin is a 26-residue peptide originally isolated from venom of the European honeybee. Melittin is a cationic, hemolytic peptide from honey bee venom. Melittin lowers the surface tension at the plasma membrane and causes cell lysis. Melittin exhibits potent anti-inflammatory and antimicrobial activity. Melittin has been extensively used as a model peptide for observing membrane lipid-protein interactions.</p>

<p>This peptide is phosphorylated by Janus kinase 2 (JAK2) and is an ideal substrate for use in kinase assays. The JAK family of kinases is essential for the signalling of a host of immune modulators in tumour, stromal, and immune cells where they are highly expressed. JAK family proteins mediate the signalling of the interferon (IFN), IL-6, and IL-2 families of cytokines.JAK kinases are associated with cytokine receptors. Cytokine binding to these receptors results in activation of JAK kinases and receptor phosphorylation. Phosphorylated cytokine receptors recruit STAT proteins, which are then phosphorylated by the activated JAK kinases. Phosphorylated STAT proteins form homo- and hetero-dimers that translocate into the nucleus and function as transcription factors.</p>

<p>Cyclic DAG peptide targets connective tissue growth factor (CTGF/CCN2), present in the extracellular matrix, endothelial cells and overexpressed in several brain diseases. CTGF is a matricellular protein that acts as a regulator of several cellular functions, including cell adhesion, migration, mitogenesis, differentiation, and survival. CTGF is up regulated in Alzheimer's disease, Parkinson's disease, brain injury, glioblastoma, and cerebral infarction.DAG peptide has been shown to home to the brain in mouse models of glioblastoma, traumatic brain injury, and Parkinson's disease when exogenously delivered, making it an attractive target for the treatment of glioblastoma. DAG may be of use as a tool to enhance delivery of therapeutics and imaging agents to sites of brain diseases.</p>

<p>During extraction of lecithin from egg yolk, peptide by-products can be isolated and purified by gel filtration. Within the by-products this has led to the discovery of biologically active value-added products. The egg yolk gel filtration (EFGF) fractions were analysed for their antioxidant and angiotensin converting enzyme (ACE) inhibitory activities. EYGF-33 predominantly contained 3 peptides - KLSDW, YPSPV, and MPVHTDAD). YPSPV in EYGF-33 was found to have minimal antioxidant activity. However, YPSPV showed notably high angiotensin converting enzyme (ACE) inhibitory activity, it exceeded the positive control captopril.</p>

<p>β-Amyloid 1-10 (Aβ1-10) is one of many short Aβ species found in vivo and is formed by the cleavage of amyloid β precursor protein by β- and α-secretase.-Amyloid β-protein (Aβ) has been identified as the key subunit of the extracellular plaques found in the brains of patients with Alzheimer disease (AD) and Down syndrome (DS). Aβ has therefore been extensively studied as a potential target for treatment of AD.Aβ is formed from the cleavage of the large, transmembrane protein- APP (amyloid precursor protein). Cleavage of APP by β- and then α-secretases results in the formation of Aβ. Aβ can aggregate to produce amyloid-β oligomers, which are thought to be highly neurotoxic. Over time Aβ can further aggregate to produce the characteristic senile plaques present in AD and DS. Aβ can be degraded by enzymes such as neprilysin, insulin degrading enzyme or endothelin converting enzyme. At physiological levels Aβ may be involved in controlling synaptic activity and neuronal survival. Biotin is C-terminally linked to the peptide via ethylenediamine-for convenient detection and purification. Alternative β-Amyloid fragments and labels are also available, please refer to our peptide catalogue for availability.</p>

<p>Uromodulin (179-185) is derived from uromodulin which is produced by the kidney and excreted in the urine. It can be used as a marker of progressive kidney disease and to investigate renal tubular function.</p>

<p>Portion of EBV EBNA3A</p>

<p>Uromodulin (186-200) is derived from uromodulin which is produced by the kidney and excreted in the urine. It can be used as a marker of progressive kidney disease and to investigate renal tubular function.</p>

<p>The coronavirus (CoV) nucleoprotein is the major component of CoV structural proteins. The nucleoprotein has a critical role in virus assembly and RNA transcription. The nucleoprotein is essential in the formation of helical ribonucleoproteins and in regulating viral RNA synthesis. The nucleoprotein can also regulate infected host cellular mechanisms. It is highly expressed during infection and may induce protective immune responses against SARS-CoV and SARS-CoV-2.The nucleoprotein residues DKDPNFKDQVILLNK (341-355) from SARS-CoV-2 have been identified as a T-cell epitope with a predicted HLA restriction. Immune targeting of confirmed epitopes may potentially offer protection against SARS-CoV-2 and help the development of vaccines for long-lasting immunity.</p>

<p>H-SGQQQGLPRAAGGSVPC-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-SGQQQGLPRAAGGSVPC-OH is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-SGQQQGLPRAAGGSVPC-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-SGQQQGLPRAAGGSVPC-OH at the technical inquiry form on this page</p>