Product correctly added to cart.

Biochemicals and Reagents
Biochemicals and Reagents

Biochemicals and Reagents

Biochemicals and reagents are fundamental substances for research and development in fields such as biotechnology, molecular biology, pharmacology, and medicine. These products are essential for a variety of applications, including compound synthesis, biological sample analysis, metabolic process research, and drug production. At CymitQuimica, we offer a wide selection of high-quality, high-purity biochemicals and reagents suitable for various scientific and industrial needs. Our catalog includes enzymes, antibodies, nucleic acids, amino acids, and many other products, all designed to support researchers and professionals in their research and development projects, ensuring reliable and reproducible results.

Read more

Products of "Biochemicals and Reagents"

Sort by


See more categories

This search does not contain any category.

products per page. 178190 products on this category.

discount label

H-DTDSEEEIR^-OH


Ref: 3D-PP48496

Undefined sizeTo inquire
Estimated delivery in United States, on Friday 18 Oct 2024
discount label

H-VTSAPDTRPAPGSTAPPAHG-NH2


Ref: 3D-PP44176

Undefined sizeTo inquire
Estimated delivery in United States, on Friday 18 Oct 2024
discount label

Myr-RIIDLLWRVRRPQKPKFVTVWVR-OH


Ref: 3D-PP45291

Undefined sizeTo inquire
Estimated delivery in United States, on Friday 18 Oct 2024
discount label

MAGE-3 (119-134)


Ref: 3D-PP50550

Undefined sizeTo inquire
Estimated delivery in United States, on Friday 18 Oct 2024
discount label

H-LQHLVNEL^THDIITK-OH


Ref: 3D-PP49757

Undefined sizeTo inquire
Estimated delivery in United States, on Friday 18 Oct 2024
discount label

H-ERFAVNPGL-OH


Ref: 3D-VAB-00894

1mg246.00 €
Estimated delivery in United States, on Friday 18 Oct 2024
discount label

H-Gly-Ala-Ala-OH


Ref: 3D-PP50640

Undefined sizeTo inquire
Estimated delivery in United States, on Friday 18 Oct 2024
discount label

H-CGRYLTQETNKVETYKEQPLKTPGKKKKGKPGKRKEQEKKKRRTR-NH2


Ref: 3D-PP49768

Undefined sizeTo inquire
Estimated delivery in United States, on Friday 18 Oct 2024
discount label

H-SGAQATWTELPWPHEK^-OH


Ref: 3D-PP41651

Undefined sizeTo inquire
Estimated delivery in United States, on Friday 18 Oct 2024
discount label

H-CGSDALDDFDLDML-NH2


Ref: 3D-PP44855

Undefined sizeTo inquire
Estimated delivery in United States, on Friday 18 Oct 2024
discount label

Ac-HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2


Ref: 3D-PP47625

Undefined sizeTo inquire
Estimated delivery in United States, on Friday 18 Oct 2024
discount label

H-FVNEEALR^-OH


Ref: 3D-PP49082

Undefined sizeTo inquire
Estimated delivery in United States, on Friday 18 Oct 2024
discount label

RifapentineHydrochloride


Ref: 3D-FR146886

Undefined sizeTo inquire
Estimated delivery in United States, on Friday 18 Oct 2024
discount label

5Azido-RKKRRQRRR-NH2


Ref: 3D-PP48836

Undefined sizeTo inquire
Estimated delivery in United States, on Friday 18 Oct 2024
discount label

H-YYGYTGAFR^-OH


Ref: 3D-PP40099

Undefined sizeTo inquire
Estimated delivery in United States, on Friday 18 Oct 2024
discount label

Rubella Virus Antigen


Ref: 3D-AW6088-R

1mg2,714.00 €
Estimated delivery in United States, on Friday 18 Oct 2024
discount label

H-FLPSDFFP^SV^-OH


Ref: 3D-PP48463

Undefined sizeTo inquire
Estimated delivery in United States, on Friday 18 Oct 2024
discount label

H-VLTPELYAELR^-OH


Ref: 3D-PP42089

Undefined sizeTo inquire
Estimated delivery in United States, on Friday 18 Oct 2024
discount label

HXB2 gag NO-75/aa297 - 311


Ref: 3D-PP51017

Undefined sizeTo inquire
Estimated delivery in United States, on Friday 18 Oct 2024
discount label

Baclofen - Bio-X ™


Ref: 3D-BB166152

10mg98.00 €
Estimated delivery in United States, on Friday 18 Oct 2024
Welcome to CymitQuimica!We use cookies to enhance your visit. We do not include advertising.

Please see our Cookies Policy for more details or adjust your preferences in "Settings".