Biochemicals and Reagents

Rabbit polyclonal FOXO1A antibody

The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections and contains active compounds that exhibit bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, preventing transcription and replication, thus inhibiting bacterial growth. Extensive research has shown its high frequency of human activity using a patch-clamp technique on human erythrocytes. Metabolically, it undergoes various transformations such as hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits their cell growth in culture.

Purified Rabbit polyclonal FOXL2 antibody (Ser263)

PGRMC1 antibody was raised using the N terminal of PGRMC1 corresponding to a region with amino acids MAAEDVVATGADPSDLESGGLLHEIFTSPLNLLLLGLCIFLLYKIVRGDQ

SCN1B antibody was raised using the middle region of SCN1B corresponding to a region with amino acids NVTYNHSGDYECHVYRLLFFENYEHNTSVVKKIHIEVVDKANRDMASIVS

The GAD67 antibody is a polyclonal antibody that targets autoantibodies against the enzyme glutamate decarboxylase 67 (GAD67). This antibody is commonly used in Life Sciences research to study the role of GAD67 in various biological processes. It can be used for applications such as immunohistochemistry, Western blotting, and ELISA.

MCP2 antibody was raised in rabbit using recombinant human MCP-2 as the immunogen.

The SNAP25 antibody is a monoclonal antibody that specifically targets clostridial neurotoxins. It is widely used in the field of Life Sciences for research purposes. This antibody has been shown to effectively neutralize the effects of clostridial neurotoxins by binding to them and preventing their interaction with target cells. The SNAP25 antibody is highly specific and does not cross-react with other proteins or molecules commonly found in biological samples. It has been extensively tested in various sample matrices, including human serum, and has shown excellent performance. Additionally, this antibody has been proven to be stable under different storage conditions and retains its activity even after multiple freeze-thaw cycles. Researchers rely on the SNAP25 antibody for its reliability and accuracy in detecting and quantifying clostridial neurotoxins in their experiments.

Rabbit polyclonal TNNI3 antibody (Ser22+Ser23)

Rabbit polyclonal Tubulin alpha antibody

The beta Tubulin antibody is a highly specific monoclonal antibody that targets the beta-tubulin protein. This protein plays a crucial role in cell division and is essential for the formation of microtubules, which are involved in various cellular processes such as intracellular transport and cell shape maintenance.

The ID3 antibody is a monoclonal antibody that specifically targets and binds to the protein ID3. This protein is involved in cholinergic signaling and plays a crucial role in various cellular processes. The ID3 antibody can be used for research purposes, such as studying the function of ID3 in different cell types or investigating its role in disease development.

Synthetic human phosphopeptide nNOS (Ser847) region immunogen, Rabbit polyclonal nNOS antibody (Ser852)

Armenian Hamster monoclonal CCL2 antibody (PE)

OSBPL3 antibody was raised using the N terminal of OSBPL3 corresponding to a region with amino acids MMSDEKNLGVSQKLVSPSRSTSSCSSKQGSRQDSWEVVEGLRGEMNYTQE