Biochemicals and Reagents
Biochemicals and reagents are fundamental substances for research and development in fields such as biotechnology, molecular biology, pharmacology, and medicine. These products are essential for a variety of applications, including compound synthesis, biological sample analysis, metabolic process research, and drug production. At CymitQuimica, we offer a wide selection of high-quality, high-purity biochemicals and reagents suitable for various scientific and industrial needs. Our catalog includes enzymes, antibodies, nucleic acids, amino acids, and many other products, all designed to support researchers and professionals in their research and development projects, ensuring reliable and reproducible results.
Subcategories of "Biochemicals and Reagents"
- Biomolecules(98,575 products)
- By Biological Target(100,710 products)
- By Pharmacological Effects(6,937 products)
- Cryopreservatives(21 products)
- Desinfectants and Related Compounds(28 products)
- Hormones(421 products)
- Plant Biology(6,907 products)
- Secondary Metabolites(14,367 products)
Found 130493 products of "Biochemicals and Reagents"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
KHDRBS3 antibody
KHDRBS3 antibody was raised using the N terminal of KHDRBS3 corresponding to a region with amino acids MEEKYLPELMAEKDSLDPSFTHALRLVNQEIEKFQKGEGKDEEKYIDVVIDDX5 antibody
DDX5 antibody was raised using a synthetic peptide corresponding to a region with amino acids SFGSNFVSAGIQTSFRTGNPTGTYQNGYDSTQQYGSNVPNMHNGMNQQAYVEGFB Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of VEGFB antibody, catalog no. 70R-9647Purity:Min. 95%Rabbit anti Mouse IgG1 (biotin)
Rabbit anti-mouse IgG1 (biotin) was raised in rabbit using murine IgG1 heavy chain as the immunogen.Purity:Min. 95%EIF2S1 antibody
EIF2S1 antibody was raised using the N terminal of EIF2S1 corresponding to a region with amino acids VVVIRVDKEKGYIDLSKRRVSPEEAIKCEDKFTKSKTVYSILRHVAEVLE
ArpT1 antibody
Arp-T1 antibody was raised in Guinea Pig using synthetic N-terminal domain of human Arp-T1 protein coupled to KLH as the immunogen.
Purity:Min. 95%alpha Synuclein antibody
The alpha Synuclein antibody is a highly specialized monoclonal antibody that is used in Life Sciences research. This antibody specifically targets and binds to alpha Synuclein, a protein that plays a crucial role in the pathogenesis of neurodegenerative diseases such as Parkinson's disease. By binding to alpha Synuclein, this antibody inhibits its activity and prevents the formation of toxic aggregates, which are believed to be responsible for the progression of these diseases. Additionally, this antibody has been shown to have anti-inflammatory properties by inhibiting the production of interleukin-6, a pro-inflammatory cytokine. With its high specificity and potent inhibitory effects, the alpha Synuclein antibody is an invaluable tool for researchers studying neurodegenerative disorders and developing potential therapeutic interventions.Purity:Min. 95%CXCL4 antibody
The CXCL4 antibody is a highly effective monoclonal antibody that targets multidrug-resistant bacteria. It contains histidine residues that enhance its binding affinity and specificity. This antibody has been extensively studied for its potential in treating various diseases, including cancer and neurodegenerative disorders.OR2M5 antibody
OR2M5 antibody was raised in rabbit using the C terminal of OR2M5 as the immunogen
Purity:Min. 95%NRCAM antibody
The NRCAM antibody is a growth factor that plays a crucial role in various biological processes. It is commonly used in Life Sciences research for its ability to detect autoantibodies and virus surface antigens. This antibody can be used in a variety of applications, including immunohistochemistry, Western blotting, and ELISA. The NRCAM antibody is available as both polyclonal and monoclonal antibodies, allowing researchers to choose the best option for their specific experiment. With its high specificity and sensitivity, this antibody ensures accurate and reliable results. Additionally, it can be conjugated with colloidal gold or other markers for enhanced detection. Whether you're studying protein expression or investigating immune responses, the NRCAM antibody is an invaluable tool in your research arsenal.SLC39A7 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of SLC39A7 antibody, catalog no. 70R-6256
Purity:Min. 95%SGK1 antibody
The SGK1 antibody is a highly specialized antibody that targets the dopamine-regulated protein kinase SGK1. It is available in both polyclonal and monoclonal forms, making it suitable for a wide range of research applications. This antibody has been extensively tested and validated for its specificity and sensitivity.
