Biochemicals and Reagents

MRPL47 antibody was raised using the middle region of MRPL47 corresponding to a region with amino acids VVQEREDALRLLQTGQERARPGAWRRDIFGRIIWHKFKQWVIPWHLNKRY

A synthetic peptide for use as a blocking control in assays to test for specificity of PPP4C antibody, catalog no. 70R-3051

The DGKA antibody is a monoclonal antibody used in Life Sciences research. It specifically targets the nuclear growth factor tyrosine kinase receptor and calmodulin. This antibody has been extensively studied for its role in various cellular processes, including the regulation of actin filaments and the production of interleukin-6. Additionally, it has shown potential therapeutic applications in the field of steroid and chemokine research. The DGKA antibody is a valuable tool for scientists studying these pathways and exploring new avenues for drug development.

Purified Polyclonal POLR2H antibody

The Chlorpyrifos antibody is a monoclonal antibody produced by a hybridoma cell line. It is designed to specifically bind to chlorpyrifos, an organophosphate insecticide commonly used in agriculture. This antibody can be used for various applications in the field of Life Sciences, including immunoassays and research studies.

XRCC3 antibody was raised in rabbit using the middle region of XRCC3 as the immunogen

Rabbit polyclonal DNAPK antibody (Ser2056)

Purified recombinant Human UFM1 protein

SLC6A2 antibody was raised in rabbit using the middle region of SLC6A2 as the immunogen

MLH1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MIENCLDAKSTSIQVIVKEGGLKLIQIQDNGTGIRKEDLDIVCERFTTSK

Purified recombinant CD3G protein (His tag)

The Ferritin antibody is a powerful tool used in the field of Life Sciences. This monoclonal antibody specifically targets ferritin, a protein responsible for storing iron in cells. By binding to ferritin, this antibody can be activated to perform various functions.

Mouse monoclonal NPR3 antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of DFFB antibody, catalog no. 70R-5928

The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is specifically designed to combat tuberculosis infection by targeting active compounds and exhibiting bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, preventing transcription and replication, which inhibits bacterial growth. The effectiveness of this drug has been demonstrated through extensive research using the patch-clamp technique on human erythrocytes. It undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically binds to markers expressed in Mycobacterium tuberculosis strains and inhibits cell growth in culture.

Hamster RBC antibody was raised in rabbit using hamster erythrocytes as the immunogen.