Biochemicals and Reagents
Subcategories of "Biochemicals and Reagents"
- Biomolecules(98,557 products)
- By Biological Target(101,015 products)
- By Pharmacological Effects(6,941 products)
- Cryopreservatives(21 products)
- Desinfectants and Related Compounds(28 products)
- Hormones(530 products)
- Plant Biology(6,903 products)
- Secondary Metabolites(14,369 products)
Found 130563 products of "Biochemicals and Reagents"
SSRP1 antibody
The SSRP1 antibody is a highly potent growth factor that acts as a phosphatase in various bioassays. It is specifically activated by human serum and has neutralizing properties. This antibody, widely used in Life Sciences research, targets tyrosine kinase receptors and 3-kinases to regulate cellular processes. It can be utilized in electrode-based experiments and is commonly employed in the field of Antibodies research. Additionally, the SSRP1 antibody has been found to exhibit genotoxic effects and shows potential as an anti-beta amyloid agent for combating amyloid protein-related disorders.
USP48 antibody
USP48 antibody was raised using the C terminal of USP48 corresponding to a region with amino acids PQSGEWYKFNDEDIEKMEGKKLQLGIEEDLAEPSKSQTRKPKCGKGTHCSPurity:Min. 95%TG02 (Double bond E)
CAS:TG02 is a high-purity synthetic peptide that acts as an activator of the protein receptor. TG02 can be used as a research tool for cell biology and pharmacology studies. It has been shown to activate ion channels and ligand-gated ion channels, including nicotinic acetylcholine receptors, 5-HT3 receptors, NMDA receptors, and GABA A receptors. TG02 also has been shown to inhibit the activity of Ligands that bind to these same protein receptor. TG02 is a small molecule that binds to the GluR2 subunit of the AMPA receptor in rat brain tissue with an IC 50 value of 0.27 μM.Formula:C23H24N4OPurity:Min. 95%Molecular weight:372.46 g/molAIF antibody
The AIF antibody is a monoclonal antibody that specifically targets the apoptosis-inducing factor (AIF). This antibody has been widely used in life sciences research to study the role of AIF in various cellular processes. It acts as a neutralizing agent, inhibiting the activity of AIF and preventing its interaction with other proteins in the cell. The AIF antibody has shown promise as a potential therapeutic agent for diseases involving abnormal cell growth, such as cancer. Its ability to bind to specific antigens makes it a valuable tool for researchers studying protein complexes and signaling pathways. Additionally, this antibody has been found to interact with other molecules involved in lipid metabolism, insulin-like growth factor signaling, and nuclear receptors such as the mineralocorticoid receptor.HKR1 antibody
HKR1 antibody was raised in rabbit using the N terminal of HKR1 as the immunogenPurity:Min. 95%NUDT21 antibody
NUDT21 antibody was raised in mouse using recombinant Human Nudix (Nucleoside Diphosphate Linked Moiety X)-Type Motif 21 (Nudt21)RPN2 antibody
The RPN2 antibody is a highly specialized antibody used in the field of Life Sciences. It is commonly used in research and diagnostic applications to study insulin and its related functions. This antibody is available in both polyclonal and monoclonal forms, allowing researchers to choose the most appropriate option for their specific needs.
Fgf3 antibody
Fgf3 antibody was raised in rabbit using the C terminal of Fgf3 as the immunogenPurity:Min. 95%EIF4H antibody
EIF4H antibody was raised using the C terminal of EIF4H corresponding to a region with amino acids TEEERAQRPRLQLKPRTVATPLNQVANPNSAIFGGARPREEVVQKEQE
RP11-78J21.1 antibody
RP11-78J21.1 antibody was raised using the N terminal of RP11-78J21.1 corresponding to a region with amino acids MSKSASPKEPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPN
