Biochemicals and Reagents
Biochemicals and reagents are fundamental substances for research and development in fields such as biotechnology, molecular biology, pharmacology, and medicine. These products are essential for a variety of applications, including compound synthesis, biological sample analysis, metabolic process research, and drug production. At CymitQuimica, we offer a wide selection of high-quality, high-purity biochemicals and reagents suitable for various scientific and industrial needs. Our catalog includes enzymes, antibodies, nucleic acids, amino acids, and many other products, all designed to support researchers and professionals in their research and development projects, ensuring reliable and reproducible results.
Subcategories of "Biochemicals and Reagents"
- Biomolecules(98,622 products)
- By Biological Target(100,423 products)
- By Pharmacological Effects(6,927 products)
- Cryopreservatives(21 products)
- Desinfectants and Related Compounds(28 products)
- Hormones(353 products)
- Plant Biology(6,913 products)
- Secondary Metabolites(14,362 products)
Found 130307 products of "Biochemicals and Reagents"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
MIP3 alpha antibody
MIP3 alpha antibody was raised in mouse using highly pure recombinant human MIP-3 alpha as the immunogen.YIPF6 antibody
YIPF6 antibody was raised using the C terminal of YIPF6 corresponding to a region with amino acids MVRLFVVIVMFAWSIVASTALLADSQPPNRRALAVYPVFLFYFVISWMILPurity:Min. 95%GSTM2 antibody
GSTM2 antibody was raised using a synthetic peptide corresponding to a region with amino acids TQSNAILRYIARKHNLCGESEKEQIREDILENQFMDSRMQLAKLCYDPDFABL1 antibody
The ABL1 antibody is a monoclonal antibody that specifically targets the growth factor receptor ABL1. This biomolecule plays a crucial role in cell growth, division, and survival. The ABL1 antibody is designed to bind to the activated form of ABL1, neutralizing its function and preventing further downstream signaling.TOP2B antibody
TOP2B antibody was raised in rabbit using the middle region of TOP2B as the immunogenPurity:Min. 95%GAL3ST3 antibody
GAL3ST3 antibody was raised using the C terminal of GAL3ST3 corresponding to a region with amino acids VDIMGYDLPGGGAGPATEACLKLAMPEVQYSNYLLRKQKRRGGARARPEPPurity:Min. 95%PDE3A antibody
PDE3A antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.Purity:Min. 95%Morphine + Oxycodone antibody
Morphine/Oxycodone antibody was raised in mouse using Oxycodone-BSA as the immunogen.ZFP36 antibody
The ZFP36 antibody is a highly effective neutralizing agent that targets the TGF-beta protein. This monoclonal antibody contains histidine and is designed to inhibit the function of TGF-beta, a key molecule involved in various cellular processes. It acts as a potent family kinase inhibitor, blocking the activity of target molecules and preventing their downstream effects.BMPR2 antibody
The BMPR2 antibody is a highly specialized monoclonal antibody used in Life Sciences. It is designed to target and bind to the BMPR2 protein, which plays a crucial role in various cellular processes. This antibody is widely used in research and diagnostic applications due to its ability to detect and quantify the expression of BMPR2.
