Biochemicals and Reagents
Subcategories of "Biochemicals and Reagents"
- Biomolecules(98,563 products)
- By Biological Target(101,024 products)
- By Pharmacological Effects(6,952 products)
- Cryopreservatives(21 products)
- Desinfectants and Related Compounds(28 products)
- Hormones(531 products)
- Plant Biology(6,903 products)
- Secondary Metabolites(14,369 products)
Found 130609 products of "Biochemicals and Reagents"
Onecut1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of Onecut1 antibody, catalog no. 70R-7887Purity:Min. 95%CDC42EP5 antibody
CDC42EP5 antibody was raised using a synthetic peptide corresponding to a region with amino acids HVGRGGDAFGDTSFLSRHGGGPPPEPRAPPAGAPRSPPPPAVPQSAAPSPTestosterone Antibody
The Testosterone Antibody is a highly specialized monoclonal antibody that targets and inhibits the activity of testosterone, a key steroid hormone in the human body. This antibody is designed to specifically bind to testosterone molecules, neutralizing their effects and preventing them from interacting with their target receptors.
ANXA1 antibody
The ANXA1 antibody is a highly specialized antibody that targets the adipocyte-specific antigen, Annexin A1 (ANXA1). This monoclonal antibody is widely used in Life Sciences research to study the role of ANXA1 in various biological processes. It specifically recognizes and binds to ANXA1, allowing researchers to investigate its function and regulation.Annexin A5 antibody
Annexin A5 antibody was raised using the N terminal of ANXA5 corresponding to a region with amino acids AYELKHALKGAGTNEKVLTEIIASRTPEELRAIKQVYEEEYGSSLEDDVVSERPINA4 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of SERPINA4 antibody, catalog no. 70R-9713Purity:Min. 95%Human Cerebellum Tissue Lysate
Freshly prepared tissue lysate isolated from cerebellum of human brainPurity:Min. 95%LRRFIP2 antibody
LRRFIP2 antibody was raised in rabbit using the N terminal of LRRFIP2 as the immunogenPurity:Min. 95%hnRNP A1 antibody
The hnRNP A1 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It specifically binds to hnRNP A1, which is one of the key binding proteins involved in various cellular processes. This antibody has been extensively studied for its role in regulating gene expression, RNA processing, and protein synthesis.
BAD antibody
The BAD antibody is a nuclear hormone peptide that is used in recombination studies. It is available as both a monoclonal and polyclonal antibody. This antibody specifically targets glycopeptides, glycoproteins, and glycans, making it an effective anti-connexin agent. The BAD antibody has neutralizing properties and has been shown to be neuroprotective. Its ability to target specific glycosylation patterns makes it a valuable tool in studying the role of antibodies in various biological processes. Additionally, the BAD antibody is colloidal in nature, allowing for easy dispersion and application in research settings.Purity:Min. 95%PDI antibody
The PDI antibody is a highly specialized antibody that plays a crucial role in various biological processes. It has been extensively studied and proven to be effective in targeting tumor necrosis factor-alpha (TNF-α), a growth factor associated with inflammation and immune response. This antibody has also shown promising results in inhibiting multidrug resistance, making it an important tool in cancer research.
