Biochemicals and Reagents
Subcategories of "Biochemicals and Reagents"
- Biomolecules(98,557 products)
- By Biological Target(101,014 products)
- By Pharmacological Effects(6,941 products)
- Cryopreservatives(21 products)
- Desinfectants and Related Compounds(28 products)
- Hormones(530 products)
- Plant Biology(6,903 products)
- Secondary Metabolites(14,371 products)
Found 130589 products of "Biochemicals and Reagents"
Rat anti Mouse IgG1
Rat anti Mouse IgG1 is a globulin-based antibody that is commonly used in Life Sciences research. It is specifically designed to neutralize and bind to Mouse IgG1 antibodies, making it an essential tool for various laboratory applications. This antibody-drug has been extensively tested and validated for its high specificity and potency. It can be used as a secondary antibody in immunoassays such as ELISA, Western blotting, and immunohistochemistry. Rat anti Mouse IgG1 has been proven to effectively detect and quantify target proteins, hormones, enzymes, chemokines, and other biomolecules of interest. With its exceptional performance and reliable results, this antibody is a valuable asset for researchers in the field of Life Sciences.
Purity:Min. 95%SLC39A4 antibody
SLC39A4 antibody was raised using a synthetic peptide corresponding to a region with amino acids PQCLSVEDALGLGEPEGSGLPPGPVLEARYVARLSAAAVLYLSNPEGTCE
Purity:Min. 95%LDHD Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of LDHD antibody, catalog no. 70R-3502
Purity:Min. 95%DMRTA2 antibody
DMRTA2 antibody was raised in rabbit using the C terminal of DMRTA2 as the immunogenPurity:Min. 95%CTIP antibody
The CTIP antibody is a highly specialized antibody used in the field of Life Sciences. It is a polyclonal antibody that specifically targets CTIP, a growth factor involved in various cellular processes. This antibody has been extensively studied and proven to be effective in detecting and quantifying CTIP levels in samples. Additionally, it has been shown to have an affinity for other molecules such as epidermal growth factor (EGF), β-catenin, anti-VEGF, c-myc, and glycopeptide. The CTIP antibody is widely used in research settings to investigate the role of CTIP in different biological pathways, including neurotrophic signaling and fas-mediated apoptosis. Its specificity and ability to detect glycosylation patterns make it a valuable tool for scientists studying cellular processes at the molecular level.Mesothelin antibody
Mesothelin antibody was raised using the middle region of MSLN corresponding to a region with amino acids QKLLGPHVEGLKAEERHRPVRDWILRQRQDDLDTLGLGLQGGIPNGYLVLPurity:Min. 95%Hantavirus (Puumala) antibody
Hantavirus (Puumala) antibody was raised in mouse using recombinant Puumala nucleocapsid protein as the immunogen.Luteinizing Hormone antibody (Prediluted for IHC)
Rabbit polyclonal Luteinizing Hormone antibody (Prediluted for IHC)Purity:Min. 95%JMJD2C Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of JMJD2C antibody, catalog no. 70R-7961
Purity:Min. 95%NFKB p65 antibody
NFKB p65 antibody was raised in Mouse using a purified recombinant fragment of human NF kappa B p65 expressed in E. coli as the immunogen.GPRC5A antibody
The GPRC5A antibody is a monoclonal antibody that specifically targets transthyretin, an antigen found in human hepatocytes. This antibody is widely used in the field of Life Sciences for various applications, including research assays and as a tool for studying growth factors. The GPRC5A antibody has been shown to effectively bind to transthyretin and inhibit its activity. It contains specific amino acid residues that enable it to recognize and bind to the target antigen with high affinity. This monoclonal antibody can be used in both activated and non-activated forms, making it versatile for different experimental conditions. In addition, the GPRC5A antibody is available as both monoclonal and polyclonal antibodies, providing researchers with options based on their specific needs. With its ability to selectively target transthyretin, the GPRC5A antibody is a valuable tool in the study of this protein and its role in various biological processes.NNT1 antibody
NNT1 antibody was raised in rabbit using highly pure recombinant human NNT-1/BCSF-3 as the immunogen.Purity:Min. 95%
