Biochemicals and Reagents

A synthetic peptide for use as a blocking control in assays to test for specificity of STK11 antibody, catalog no. 70R-9641

Caspase 1 antibody is a highly specific antibody that targets caspase 1, an enzyme involved in the inflammatory response. This antibody has been extensively tested and validated using human serum samples. It has been shown to effectively detect and quantify caspase 1 levels in various biological samples.

SCO1 antibody was raised using a synthetic peptide corresponding to a region with amino acids ALLAGMKHVKKEKAEKLEKERQRHIGKPLLGGPFSLTTHTGERKTDKDYL

DONSON antibody was raised using the middle region of DONSON corresponding to a region with amino acids DLITALISPTTRGLREAMRNEGIEFSLPLIKESGHKKETASGTSLGYGEE

A synthetic peptide for use as a blocking control in assays to test for specificity of ISCA2 antibody, catalog no. 70R-2471

The MMP7 antibody is a highly specific monoclonal antibody that targets the matrix metalloproteinase 7 (MMP7) enzyme. MMP7 plays a crucial role in various biological processes, including tissue remodeling, wound healing, and cell proliferation. This antibody is widely used in Life Sciences research to study the function and regulation of MMP7.

A synthetic peptide for use as a blocking control in assays to test for specificity of ZG16 antibody, catalog no. 70R-5441

EEF1G antibody was raised using the N terminal of EEF1G corresponding to a region with amino acids AAQYSGAQVRVLSAPPHFHFGQTNRTPEFLRKFPAGKVPAFEGDDGFCVF

Mouse monoclonal DO11.10 TCR antibody (PE)

Rabbit polyclonal ZNF259 antibody

Protein C antibody is a highly specialized antibody that targets the activated form of protein C, an important regulator of blood coagulation. This antibody specifically recognizes the active form of protein C and can be used in various research applications, particularly in the field of life sciences.

Purified recombinant Human FDCSP protein (His tag)

A synthetic peptide for use as a blocking control in assays to test for specificity of JMJD2B antibody, catalog no. 70R-2723

Purified Polyclonal SERINC2 antibody

The Synaptotagmin antibody is a highly specialized polyclonal antibody that is used in various assays and experiments in the field of Life Sciences. This antibody has the unique ability to neutralize the activity of glucose-6-phosphate, making it an essential tool for studying the role of this molecule in cellular processes. The Synaptotagmin antibody is available in both monoclonal and polyclonal forms, providing researchers with options to suit their specific needs. With its high affinity and specificity, this antibody can be used for a wide range of applications, including immunohistochemistry, Western blotting, and flow cytometry. Whether you are studying protein-protein interactions or investigating disease mechanisms, the Synaptotagmin antibody is an indispensable tool for your research. Trust in its reliability and accuracy to deliver accurate and reproducible results every time.

A synthetic peptide for use as a blocking control in assays to test for specificity of KCNH2 antibody, catalog no. 70R-5165

The PNPase antibody is a valuable tool in Life Sciences research. It is a polyclonal antibody that specifically targets the alpha-synuclein protein. This antibody can be used for various applications, including Western blotting, immunohistochemistry, and immunofluorescence.

A synthetic peptide for use as a blocking control in assays to test for specificity of ABRA antibody, catalog no. 70R-9194