Carboxylic Acids

<p>Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine:  H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine:    H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human:  H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2</p>

<p>Ethyl 2-(chlorosulfonyl)acetate is a drug candidate that inhibits the enzyme cholesterol acyltransferase (ACAT), which is responsible for the formation of cholesterol esters. It has been shown to be effective in animal models for the treatment of metabolic disorders, such as hypercholesterolemia and hypertriglyceridemia. In addition, it has been shown to inhibit the activity of serine proteases, which are involved in coagulation, amido hydrolase, and nucleophilic attack reactions. Ethyl 2-(chlorosulfonyl)acetate has also been shown to activate gene product in cellular studies with mouse fibroblasts.</p>

<p>Amylin is a hormone that regulates the release of insulin from the pancreas. Amylin is a protein that consists of 39 amino acids, and in its natural form it is not soluble in water. The amyloid fibrils are insoluble aggregates of proteins that can be found in the brain tissue of patients with Alzheimer's disease. Amylin has been shown to have an entrapment efficiency greater than 96% by using polymeric particles with a diameter less than 50 microns. These particles are able to increase water solubility and nutrient metabolism, as well as improve evaporation rates. They also provide an increased surface area for absorption and pharmacological properties. Amylin has been shown to lower postprandial glycemia when used with insulin in type II diabetes mellitus patients, and may also be an anorectic agent.</p>

<p>Bortezomib is a proteasome inhibitor that binds to the catalytic site of the proteasome and inhibits its activity. Bortezomib is used as an anticancer agent to treat multiple myeloma, T-cell lymphomas, and other cancers. It has been shown to inhibit the growth of cancer cells and slow tumor progression in animal models. The drug has also been shown to decrease insulin resistance in mice with high blood sugar levels by inhibiting histone deacetylase (HDAC). This inhibition leads to increased expression of genes that are involved in glucose metabolism and decreased expression of genes that regulate fat production.<br>The drug also binds tightly to the insulin receptor, which may lead to improved glucose uptake into cells.</p>

<p>Please enquire for more information about Dnp-(Leu421)-Collagen Type VIII a1 Chain (419-426) amide (human, mouse) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about 5-Methylpyrimidine-2-carboxylic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Intermediate in the synthesis of afatinib</p>

<p>Please enquire for more information about Biotinyl-Neuropeptide W-23 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about tert-Butyl6-[(1e)-2-[4-(4-fluorophenyl)-6-(1-methylethyl)-2-[methyl(methylsulfonyl)amino]-5-pyrimidinyl]ethenyl]-2,2-dimethyl-1,3-di oxane-4-acetate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about GLP-1 (7-36)-Lys(6-FAM) amide (human, bovine, guinea pig, mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about LIP1 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Des-Gly10,D-Pyr 1,D-Leu6,Pro-NHEt 9)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Biotinyl-Amyloid b-Protein (1-40) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Neuropeptide FF (5-8) acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Gln11)-Amyloid b-Protein (1-28) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>H-Gly-Arg-Gly-Asp-D-Ser-Pro-OH trifluoroacetate salt (HGGDS) is a collagen gel that is used in the treatment of autoimmune diseases, such as arthritis and lupus. HGGDS inhibits the production of fibrinogen, which is a protein involved in blood clotting, by binding to its receptor on human fibroblasts. It also inhibits the production of basic proteins needed for the generation of collagen and activation of integrin receptors, which are involved in cell adhesion and migration. HGGDS also blocks transcription polymerase chain reactions (PCRs), which are necessary for the synthesis of DNA. This can lead to a decrease in cell proliferation and an increase in apoptosis.</p>

<p>Please enquire for more information about (D-Lys16)-ACTH (1-24) (human, bovine, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Z)-2-(2-Aminothiazol-4-yl)-2-(hydroxyimino)acetic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Prop-1-en-2-ylboronic acid is a chemical compound that belongs to the group of aromatic hydrocarbons. It is used in pharmaceutical preparations as a monomer and as a chiral building block for the synthesis of oxazolidinones, which are used in medicinal chemistry as protein inhibitors against cancers. Prop-1-en-2-ylboronic acid is also used as a reagent in preparative high performance liquid chromatography. This chemical has shown maximal response against colorectal carcinoma cells and has been shown to be an inhibitor of cholesterol ester transfer.</p>

<p>Please enquire for more information about Peptide YY (13-36) (canine, mouse, porcine, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>