Carboxylic Acids
Carboxylic acids are organic molecules characterized by having a carboxyl-type functional group (-COOH). These acids are fundamental in various chemical reactions, including esterification, amidation, and decarboxylation. Carboxylic acids are widely used in the production of pharmaceuticals, polymers, and agrochemicals. In this section, you can find a large number of carboxylic acids ready to be used. At CymitQuimica, we provide a broad range of high-quality carboxylic acids to support your research and industrial applications.
Found 12454 products of "Carboxylic Acids"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
2,2'-Biphenyldicarboxylic acid anhydride - 70%
CAS:2,2'-Biphenyldicarboxylic acid anhydride is a diphenic anhydride that has a carboxylate group on one end and a phenyl group on the other. The nitrogen atoms in this molecule are part of the intramolecular hydrogen bonds that stabilize the molecule. 2,2'-Biphenyldicarboxylic acid anhydride is used in wastewater treatment as it reacts with amines to form ammonium salts. This process also releases hydrogen, which can be used for fuel cells or light emission. It is also used to produce other compounds such as malonic acid and phenylacetic acid.
Formula:C14H8O3Purity:(%) Min. 70%Color and Shape:Brown Beige PowderMolecular weight:224.21 g/molAcetyl-GRP (20-26) (human, porcine, canine) trifluoroacetate salt
CAS:Acetyl-GRP (20-26) (human, porcine, canine) trifluoroacetate salt Ac-His-Trp-Ala-Val-Gly-His-Leu-NH2 trifluoroacetate salt is a prophylactic and/or therapeutic compound that has been shown to be effective in the treatment of a number of different diseases. This compound has been shown to have neuroprotective and antiinflammatory effects, as well as being an effective treatment for autoimmune disorders. Acetyl-GRP (20-26) (human, porcine, canine) trifluoroacetate salt Ac-His-Trp-Ala-Val-Gly-His-Leu NH2 trifluoroacetate salt also has the potential to be used as a prophylactic or therapeutic agent against cancer, fibrotic disease, and inflammatory disease.Formula:C41H57N13O8Purity:Min. 95%Molecular weight:859.97 g/molGRF (ovine, caprine) trifluoroacetate salt
CAS:Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine: H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine: H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2Formula:C221H368N72O66SPurity:Min. 95%Molecular weight:5,121.8 g/molPAR-2 (6-1) amide (human) trifluoroacetate salt
CAS:Please enquire for more information about PAR-2 (6-1) amide (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C28H54N8O7Purity:Min. 95%Molecular weight:614.78 g/molBenzyl acetate
CAS:Benzyl acetate is a colorless liquid that has a pleasant odor. It is used as a flavoring agent in food, beverages and tobacco products. Benzyl acetate is also used as an intermediate in the production of other chemicals. A low-dose group of rats was given benzyl acetate at doses of 0.5, 1, 5 and 10 mg/kg/day for 30 days. The animals were observed for changes in enzyme activities and thermal expansion reactions. Chronic exposure to benzyl acetate may cause carcinogenesis by inducing dimethyl fumarate (DMF) or methyl transferase activity.Formula:C9H10O2Purity:Min. 95%Color and Shape:Colorless Clear LiquidMolecular weight:150.17 g/molH-Glu(Ala-Gly-pNA)-OH trifluoroacetate salt
CAS:Please enquire for more information about H-Glu(Ala-Gly-pNA)-OH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C16H21N5O7Purity:Min. 95%Molecular weight:395.37 g/molPreptin (rat) trifluoroacetate salt
CAS:Please enquire for more information about Preptin (rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C181H268N48O51Purity:Min. 95%Molecular weight:3,932.36 g/molN-Acetoacetylcresidine sulfonic acid sodiumsalt
CAS:Please enquire for more information about N-Acetoacetylcresidine sulfonic acid sodiumsalt including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formula:C12H14NNaO6SPurity:Min. 95%Molecular weight:323.3 g/molα-Ketoglutaric acid potassium
CAS:Intermediate in the Krebs cycle; nitrogen transporter
Formula:C5H5O5KPurity:Min. 98 Area-%Color and Shape:PowderMolecular weight:184.19 g/molInfluenza PR8 Hemagglutinin Peptide (110-119) trifluoroacetate salt
CAS:Influenza PR8 Hemagglutinin Peptide (110-119) trifluoroacetate salt H-Ser-Phe-Glu-Arg-Phe-Glu-Ile-Phe-Pro-Lys-OH trifluoroacetate sa lt is a surface glycoprotein that has been shown to enhance the survival of neuronal cells. It is also involved in the regulation of energy metabolism and iron homeostasis, as well as in the induction of autoimmune diseases. This peptide contains a hydroxyl group, which can be oxidized by reactive oxygen species and may have neurotrophic effects. Trifluoroacetate salts of this protein are ester linkages that bind iron tightly and have been used for the treatment of iron overload.Formula:C63H90N14O16Purity:Min. 95%Molecular weight:1,299.47 g/mol3-Phenyl-1-adamantane carboxylic acid
CAS:3-Phenyl-1-adamantane carboxylic acid is a thioester that can be used in the synthesis of anti-fungal and antiviral agents. 3-Phenyl-1-adamantane carboxylic acid has been shown to have anti-viral activity against herpes simplex virus type 1 (HSV-1) and type 2 (HSV-2). It also has anthelmintic properties, which may be due to its ability to inhibit the growth of parasitic worms. 3PCA can also be used in the synthesis of cyclic anthelmintics, which are drugs that treat worm infestations.Formula:C17H20O2Purity:Min. 95%Color and Shape:White Off-White PowderMolecular weight:256.34 g/molPseudin-2 trifluoroacetate salt
CAS:Please enquire for more information about Pseudin-2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C122H202N36O32Purity:Min. 95%Molecular weight:2,685.13 g/molo-Cresol-4-sulphonic acid
CAS:o-Cresol-4-sulphonic acid is a fine chemical with the CAS number 7134-04-5. It is a versatile building block that can be used as a reagent in research, as a speciality chemical and as an intermediate in the production of other compounds. o-Cresol-4-sulphonic acid has been used to synthesize pharmaceuticals, agrochemicals, dyes, perfumes and many more products. This compound has also been used as a reaction component in organic synthesis to form new compounds and scaffolds.Formula:C7H8O4SPurity:Min. 95%Color and Shape:PowderMolecular weight:188.2 g/molACTH (3-24) (human, bovine, rat) trifluoroacetate salt
CAS:Please enquire for more information about ACTH (3-24) (human, bovine, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C124H196N38O27SPurity:Min. 95%Molecular weight:2,683.19 g/molZ-Arg-Arg-bNA acetate salt
CAS:Please enquire for more information about Z-Arg-Arg-bNA acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C30H39N9O4Purity:Min. 95%Molecular weight:589.69 g/mol4-Bromobutyl acetate
CAS:4-Bromobutyl acetate is a nucleic acid that contains a hydroxyl group, two nitrogen atoms, and four carbon atoms. It is the acetic ester of 4-bromobutyric acid. 4-Bromobutyl acetate can be found in the nucleus of cells and in mitochondria. It has been shown to bind to p2y receptors on the surface of cells and is thought to have tuberculostatic activity in vitro. 4-Bromobutyl acetate has also been shown to inhibit viral replication by binding to template or molecule. This nucleic acid can be used as a sequencing template because it will form complementary base pairs with other molecules that contain complementary sequences of nucleic acids.Formula:C6H11BrO2Purity:Min. 95%Molecular weight:195.05 g/molSecretin (porcine) acetate salt
CAS:Controlled ProductSecretin acetate salt H-His-Ser-Asp-Gly-Thr-Phe-Thr-Ser-Glu-Leu-Ser-Arg-Leu-Arg-Asp-Ser-Ala is a peptide that is secreted by the pancreas in response to the ingestion of food. Secretin stimulates the release of water and bicarbonate from the pancreas, as well as stimulating the gallbladder to contract, which results in increased flow of bile. Secretin also inhibits gastric acid secretion, slows intestinal motility, and stimulates pancreatic enzyme secretion. The amino acid sequence of this peptide is identical to that of leuprolide acetate (Lupron) and goserelin acetate (Zoladex), which are synthetic analogs with similar biological activity. This peptide can be synthesized on a solid phase or in solution phase. Solid phase synthesis involves attaching amino acidsFormula:C130H220N44O41Purity:Min. 95%Molecular weight:3,055.41 g/mol(Cys47)-HIV-1 tat Protein (47-57) trifluoroacetate salt
CAS:Please enquire for more information about (Cys47)-HIV-1 tat Protein (47-57) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formula:C58H114N32O13SPurity:Min. 95%Molecular weight:1,499.8 g/mol4-tert-Butylphenylboronic acid
CAS:4-tert-Butylphenylboronic acid is an aromatic hydrocarbon that belongs to the class of phenoxy. It is a molecule with nitrogen atoms and a molecular weight of 144.17 g/mol. 4-tert-Butylphenylboronic acid has been shown to form a copper complex in the presence of sodium trifluoroacetate, which is used for cross-coupling reactions. This compound also reacts with hydrochloric acid to form 4-methoxyphenylboronic acid and trimethyl boronate, which can be used as reaction products in organic synthesis. The stability of this compound has been studied using electrochemical impedance spectroscopy (EIS) on thin films.
Formula:C10H15BO2Purity:Min. 95%Color and Shape:White PowderMolecular weight:178.04 g/molAnthranilyl-HIV Protease Substrate trifluoroacetate salt
CAS:Please enquire for more information about Anthranilyl-HIV Protease Substrate trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C43H65N13O11Purity:Min. 95%Molecular weight:940.06 g/mol
