Carboxylic Acids

<p>Please enquire for more information about Big Endothelin-3 (22-41) amide (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Ac-Arg-Leu-Arg-AMC trifluoroacetate salt is a mitochondrial biogenesis activator that has been shown to increase the levels of proteins in the mitochondria. These proteins are required for mitochondrial membrane potential, ATP production, and protein homeostasis. Ac-Arg-Leu-Arg-AMC trifluoroacetate salt has been shown to increase the number of pluripotency markers in human liver cells and to reduce insulin resistance in animals. The drug also increases the expression of ubiquitin ligases and proteasomes, which are enzymes that degrade damaged proteins. Ac-Arg-Leu-Arg-AMC trifluoroacetate salt may be used for treating liver diseases or disorders as well as obesity.</p>

<p>Bromofluoroacetic acid is a synthetic, chiral molecule with the chemical formula CF3CO2H. It has the molecular weight of 109.07 and a boiling point of 212 °C. Bromofluoroacetic acid is used in industry as an intermediate for fluoroacetic acid. It is also used to manufacture bromofluorocarbons, which are used as propellants in aerosol sprays. Bromofluoroacetic acid has been studied in clinical studies as a treatment for epilepsy and as an antimicrobial agent against bacteria such as Staphylococcus aureus and Enterobacter aerogenes.</p>

<p>Please enquire for more information about H-Gly-His-Arg-Pro-NH2 acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>3-Cyclopropylmethoxy-4-difluoromethoxy-benzoic acid is an industrial chemical that is used as a binding agent in the production of dyes, rubber, and pharmaceuticals. The compound is produced by the acylation of 3-chloromethoxybenzoic acid with cyclopropylmethanol. This reaction requires an inorganic base such as potassium carbonate or sodium bicarbonate to activate the chloride. 3-Cyclopropylmethoxy-4-difluoromethoxybenzoic acid can be used as a reactive alkylating agent for the production of amides and other organic compounds, which increases its versatility.</p>

<p>Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine:  H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine:    H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human:  H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2</p>

<p>Please enquire for more information about (Asn670,Leu671)-Amyloid b/A4 Protein Precursor770 (667-676) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Cys-Gly-Lys-Lys-Gly-Amyloid b-Protein (35-40) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Arg3)-Amyloid b-Protein (1-40) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Glu(EDANS)-Lys-Pro-Ala-Lys-Phe-Phe-Arg-Leu-Lys(DABCYL)-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Spexin trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Uroguanylin Topoisomer B (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Fluorogenic Human CMV Protease Substrate trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (D-Ala6)-LHRH acetate salt Pyr-His-Trp-Ser-Tyr-D-Ala-Leu-Arg-Pro-Gly-NH2 acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Methyl 2,2-difluoro-2-(fluorosulfonyl)acetate is a chemical that belongs to the group of halides. It has a redox potential of -0.274 V (vs SCE). The methyl group in this chemical is substituted with a fluoro group and a sulfonyl group. The methyl 2,2-difluoro-2-(fluorosulfonyl)acetate has been shown to have receptor activity with dopamine as its agonist. This chemical also has an aromatic hydrocarbon ring and an oxygen atom. Methyl 2,2-difluoro-2-(fluorosulfonyl)acetate has been shown to be effective against cancer cells and may have metabolic disorders such as diabetes mellitus type II and Alzheimer's disease.</p>

<p>(S)-9,10-Difluoro-2,3-dihydro-3-methyl-7-oxo-7H-pyrido[1,2,3-de]-1,4-benzoxazine-6-carboxylic acid ethyl ester is an acidic substance that can be produced by the amination of piperazine with chloroacetic acid. The reaction solution is heated to a temperature of about 120°C for about 30 minutes and then cooled to room temperature. The product precipitates as a white solid. This compound has been shown to have antibacterial activity against methicillin resistant Staphylococcus aureus (MRSA) in plates.</p>

<p>Trifluoroacetate salt</p>

<p>Please enquire for more information about TIMP-2 (145-168) (human, bovine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>A component of Conus venom; antagonist of nicotinic acetylcholine receptors</p>

<p>Please enquire for more information about (Tyr(Me)21)-Neuropeptide Y (human, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>