Carboxylic Acids

<p>Please enquire for more information about (Deamino-Cys3, Nle 4,Arg5,D-2-Nal 7,Cys11)-a-MSH (3-11) amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Endomorphin-2 is a cyclic peptide that is the endogenous ligand for the neurokinin-1 receptor and kappa-opioid receptors. It has been shown to have analgesic, anti-inflammatory, and antidiarrheal properties. Endomorphin-2 also has been shown to inhibit platelet aggregation and vasoconstriction in vivo. The biological activities of endomorphin-2 are similar to those of endomorphin-1, but it differs structurally in that it contains a single intramolecular hydrogen bond between the amide nitrogen of Tyr and Pro. This intramolecular hydrogen bond may be responsible for the high potency of endomorphin-2, as well as its conformational stability.</p>

<p>The compound H-Tyr-Tyr-Tyr-Tyr-Tyr-Tyr-OH trifluoroacetate salt is a synthetic antigen for use in the production of immunoadsorbent conjugates. It is a postulated fluorescence molecule that interacts with specific antibodies to form an antigen. This antigen can be used as a probe for detecting antibodies in biological fluids and tissues by fluorescence microscopy and has been shown to have no antigenicity in skin reactions.</p>

<p>Please enquire for more information about 6-(7-Nitro-benzo[2,1,3]oxadiazol-4-ylamino)-hexanoyl-Arg-Pro-Lys-Pro-Leu-Ala-Nva-Trp-Lys((7-dimethylaminocoumarin-4-yl)-acetyl)-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Gly-Pen-Gly-Arg-Gly-Asp-Ser-Pro-Cys (GPEG) is a peptide that modulates the function of muscle cells and is present in collagen. GPEG has been shown to improve oxidative damage, which occurs during exercise. The effect of GPEG on muscle cells is dependent on the dose. Low doses of GPEG activate proteins that are involved in transcription and increases the synthesis of oxidative enzymes, while high doses inhibit these proteins. GPEG also modulates integrin receptor expression and decreases fibronectin production by vascular smooth muscle cells.</p>

<p>Please enquire for more information about N-Acetoacetylcresidine sulfonic acid sodiumsalt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>H-Arg-Arg-Arg-Arg-Arg-Arg-OH trifluoroacetate salt is a compound that can be used as a cancer treatment. It has been shown to inhibit the growth of human retinal pigmented epithelial cells (p. pastoris) and induce apoptosis in these cells. H-Arg-Arg-Arg-Arg-Arg-Arg-OH trifluoroacetate salt interacts with the membrane of cells, blocking the binding site for growth factor and preventing the activation of downstream signaling pathways. This agent also binds to lysine residues on peptides, which are then degraded by proteases. H-Argo Arg Arg Arg Arg Arg Arg OH trifluoroacetate salt has been shown to have an affinity for flavone luteolin at neutral pH, as well as fatty acid molecules.</p>

<p>Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine:  H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine:    H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human:  H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2</p>

<p>Please enquire for more information about Bradykinin-Like Neuropeptide (Aplysia californica) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Bortezomib is a proteasome inhibitor that binds to the catalytic site of the proteasome and inhibits its activity. Bortezomib is used as an anticancer agent to treat multiple myeloma, T-cell lymphomas, and other cancers. It has been shown to inhibit the growth of cancer cells and slow tumor progression in animal models. The drug has also been shown to decrease insulin resistance in mice with high blood sugar levels by inhibiting histone deacetylase (HDAC). This inhibition leads to increased expression of genes that are involved in glucose metabolism and decreased expression of genes that regulate fat production.<br>The drug also binds tightly to the insulin receptor, which may lead to improved glucose uptake into cells.</p>

<p>Please enquire for more information about 3,5-Dichloropyrazine-2-carboxylicacid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Des-Gly10,D-Tyr5,D-His(Bzl)6,Pro-NHEt 9)-LHRH trifluoroacetate salct including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>4-Oxo-1-adamantanecarboxylic acid is a versatile building block that can be used as a reactant and reagent in organic chemistry. It is used to synthesize various heterocyclic compounds, including the 4-oxo-1,4-dihydropyridine ring system. This compound has been shown to be useful as an intermediate or building block in the synthesis of a number of complex compounds. 4-Oxo-1-adamantanecarboxylic acid may also be used as a research chemical or speciality chemical.</p>

<p>Please enquire for more information about WRW4 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about PAR-3 (1-6) amide (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (2S)-2-Amino-4-methyl-1-[(2R)-2-methyloxiranyl]-1-pentanone trifluoroacetate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Methyl benzofuran-6-carboxylate is a synthetic retinoid that is a conformationally constrained analogue of retinoic acid, which is one of the most powerful biological molecules. Methyl benzofuran-6-carboxylate has been shown to be an effective anti-inflammatory agent and may be useful in the treatment of inflammatory skin diseases. It also inhibits the production of proinflammatory cytokines and chemokines, such as TNF-α, IL-1β, IL-8, CCL2, CXCL1, and CXCL2. Methyl benzofuran-6-carboxylate binds to specific receptors on cell surfaces to inhibit the production of inflammatory mediators. The drug also has been shown to have antiangiogenic activity. This property may be due to its ability to inhibit the production of vascular endothelial growth factor (VEGF) and other angiogenic factors.</p>

<p>2-Hydroxy-4-(methylthio)butyric acid calcium salt (2HMBAC) is a fatty acid that is found in malic acid. It is an important industrial chemical used for the preparation of other chemicals such as acetic anhydride, adipic acid, and butyric acid. 2HMBAC has been shown to have various biological functions including the inhibition of protein synthesis and the reduction of chloride ion transport. The dietary administration of 2HMBAC has been shown to relieve diarrhoea in rats.</p>

<p>Please enquire for more information about Acetyl-PACAP-38 (human, mouse, ovine, porcine, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Beta-Asp3)-VIP (human, mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>