Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,721 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(764 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,585 products)
- Metabolism Antibodies(286 products)
- Microbiology Antibodies(741 products)
- Signal Transduction(2,765 products)
- Tags & Cellular Markers(34 products)
Found 75594 products of "Primary Antibodies"
BTBD12 antibody
BTBD12 antibody was raised in rabbit using the N terminal of BTBD12 as the immunogen
Purity:Min. 95%DDC antibody
The DDC antibody is a powerful tool in the field of Life Sciences. It is an antibody that can be used for various applications, including research and diagnostic purposes. This antibody is highly specific and can recognize and bind to a target protein called DDC (dopa decarboxylase). DDC is an enzyme that plays a crucial role in the synthesis of important neurotransmitters like dopamine.
ABHD7 antibody
ABHD7 antibody was raised using the N terminal of ABHD7 corresponding to a region with amino acids HCYVRIKDSGLRFHYVAAGERGKPLMLLLHGFPEFWYSWRYQLREFKSEY
Purity:Min. 95%HIV1 antibody (HTLV3)
HIV1 antibody (HTLV3) was raised in goat using human isolate as the immunogen.Purity:Min. 95%PAX6 antibody
The PAX6 antibody is a growth factor that belongs to the class of monoclonal antibodies. It is designed to target and neutralize the PAX6 protein, which plays a crucial role in various biological processes. This antibody has been extensively studied and validated in Life Sciences research, making it a reliable tool for scientists and researchers. It can be used in experiments involving adipose tissue, nuclear signaling pathways, and other cellular processes where PAX6 is involved. The PAX6 antibody is also available as polyclonal antibodies for different applications, including the detection of chemokines, angptl3 inhibitors, and alpha-fetoprotein. With its high specificity and effectiveness, this antibody is an essential tool for studying PAX6-related mechanisms and exploring their potential therapeutic applications.
SERINC2 antibody
SERINC2 antibody was raised using the N terminal of SERINC2 corresponding to a region with amino acids VCEEGAGIPTVLQGHIDCGSLLGYRAVYRMCFATAAFFFFFTLLMLCVSS
Purity:Min. 95%Hemocyanin antibody
The Hemocyanin antibody is a valuable product in the field of Life Sciences. This antibody specifically targets fatty acids and is widely used in research involving Antibodies. It acts as a family kinase inhibitor, preventing the activation of kinases that play a crucial role in cell signaling pathways. Additionally, this antibody has been shown to interact with collagen, epidermal growth factor, and interleukin-6, making it an essential tool for studying the effects of these molecules on various biological processes.Collagen Type IV alpha 3 antibody
Collagen Type IV alpha 3 antibody was raised using a synthetic peptide corresponding to a region with amino acids PPVERCGVLSKWTNYIHGWQDRWVVLKNNALSYYKSEDETEYGCRGSICLPurity:Min. 95%DNASE1L3 antibody
DNASE1L3 antibody was raised in rabbit using the C terminal of DNASE1L3 as the immunogen
Mouse Thymocyte antibody
Mouse thymocyte antibody was raised in rabbit using RBC-free murine thymus and spleen cells as the immunogen.Purity:Min. 95%CROT antibody
The CROT antibody is a highly specialized monoclonal antibody that targets autoantibodies and has antiviral properties. It is commonly used in high-flux assays and life science research to detect and measure the levels of interleukins, carnitine, and octanoyltransferase. This antibody is designed to specifically bind to CROT protein, inhibiting its activity and preventing the formation of antibodies that can cause autoimmune diseases. With its ability to accurately detect extracellular antibodies, the CROT antibody plays a crucial role in the development of new medicines and therapies targeting autoimmune disorders.
IRX6 antibody
IRX6 antibody was raised in rabbit using the C terminal of IRX6 as the immunogen
Purity:Min. 95%alpha Actinin 1 antibody
alpha Actinin 1 antibody was raised using the N terminal of ACTN1 corresponding to a region with amino acids DHYDSQQTNDYMQPEEDWDRDLLLDPAWEKQQRKTFTAWCNSHLRKAGTQ
PAI1 antibody
PAI1 antibody was raised in sheep using Recombinant Plasminogen Activator Inhibitor-1 prepared from bacterial extracts as the immunogen.Purity:Min. 95%GPX7 antibody
The GPX7 antibody is a highly specialized monoclonal antibody that is used in various Life Sciences applications. It is specifically designed to target and neutralize GPX7, an enzyme that plays a crucial role in the regulation of oxidative stress. The antibody has been extensively tested and validated for its efficacy in laboratory experiments.
ApoH antibody
ApoH antibody was raised in goat using human Beta-2-Glycoprotein purified from plasma as the immunogen.
PFKP antibody
The PFKP antibody is a highly specialized monoclonal antibody that targets the protein kinase enzyme. It has been extensively studied for its potential therapeutic applications in various fields, including interferon research, non-alcoholic steatohepatitis treatment, and industrial protein kinase inhibitors.
ZNF624 antibody
ZNF624 antibody was raised in rabbit using the middle region of ZNF624 as the immunogen
Purity:Min. 95%Sheep RBC antibody (Texas Red)
Sheep RBC antibody (Texas Red) was raised in rabbit using sheep erythrocytes as the immunogen.
Goat anti Mouse IgG (H + L) (biotin)
This antibody reacts with heavy (gamma) chains on mouse IgG and light chains on all mouse immunoglobulins.Purity:Min. 95%Pneumolysin antibody
Pneumolysin antibody is a polyclonal antibody that is used in Life Sciences research. It specifically targets pneumolysin, a protein produced by Streptococcus pneumoniae, which is responsible for causing pneumonia and other respiratory infections. This antibody has been shown to neutralize the activity of pneumolysin, preventing its damaging effects on host cells. Pneumolysin antibody can be used in various applications such as immunohistochemistry, ELISA, and Western blotting to study the role of pneumolysin in disease progression and to develop new therapeutic strategies. With its high specificity and affinity for pneumolysin, this antibody is a valuable tool for researchers in the field of infectious diseases.
Purity:Min. 95%alpha Tubulin antibody
The alpha Tubulin antibody is a monoclonal antibody that specifically targets and neutralizes alpha-tubulin, a protein involved in the formation of actin filaments. This antibody has been shown to have high affinity for alpha-tubulin and can effectively inhibit its activity. It has also been demonstrated to bind to other proteins such as alpha-fetoprotein and receptors, further highlighting its versatility.MEK1 antibody
The MEK1 antibody is a glycopeptide that targets the growth factor receptor, specifically designed for use in Life Sciences research. This polyclonal antibody has been extensively tested and validated for its high specificity and sensitivity in detecting MEK1 protein. It can be used in various applications such as Western blotting, immunohistochemistry, and immunofluorescence.
TRAPPC6B antibody
TRAPPC6B antibody was raised using the middle region of TRAPPC6B corresponding to a region with amino acids TTVFKKQIDNLRTNHQYLAFTCGLIRGGLSNLGIKSIVTAEVSSMPACKF
CD2 antibody
The CD2 antibody is a monoclonal antibody that targets the CD2 protein, which plays a crucial role in T-cell activation and growth factor signaling. This antibody specifically binds to the activated form of CD2 and has been shown to inhibit T-cell proliferation and cytokine production. Additionally, it has hypomethylating properties, which may contribute to its anti-inflammatory effects. The CD2 antibody is commonly used in Life Sciences research for studying T-cell biology and immune responses. It can also be used in combination with other antibodies or inhibitors for antibody-drug conjugate therapy. Furthermore, this antibody has been utilized in various studies involving extracellular histones, tyrosine kinase inhibitors like imatinib, and intracellular signaling pathways such as p38 MAPK. Its versatility and specificity make it an invaluable tool for researchers in the field of immunology.
Donkey anti Rat IgG (H + L) (Fab'2) (PE)
Donkey anti-rat IgG (H + L) (Fab'2) (PE) was raised in donkey using Rat IgG (H&L) as the immunogen.
Purity:Min. 95%PSA antibody
The PSA antibody is a specific antibody that is reactive to protein carbonyls. It has been shown to be effective in ultrasensitive detection of PSA in human serum. The antibody can be used for various applications, including electrochemical impedance and carbon electrode assays. It is commonly used in Life Sciences research and is available as both monoclonal and polyclonal antibodies. The PSA antibody is highly reliable and provides accurate results for the detection of messenger RNA expression levels. It can be used in combination with aluminum hydroxide adjuvant for enhanced immune response. Trust the PSA antibody for your research needs in the field of Antibodies.
TLR4 antibody
The TLR4 antibody is a reactive and neutralizing monoclonal antibody that targets Toll-like receptor 4 (TLR4). It is commonly used in research and clinical settings to study the role of TLR4 in various biological processes. This antibody specifically binds to TLR4, preventing its interaction with ligands and downstream signaling molecules. By blocking TLR4 activation, the antibody inhibits the production of pro-inflammatory cytokines such as interleukin-6 (IL-6) and tumor necrosis factor-alpha (TNF-α). Additionally, it has been shown to inhibit the genotoxic effects of certain substances, making it a valuable tool in genotoxicity studies. The TLR4 antibody is widely used in life sciences research, particularly in the fields of immunology and inflammation. Whether you're studying cholinergic signaling or investigating fatty acid metabolism, this antibody can provide valuable insights into cellular processes regulated by TLR4. Choose our high-quality TLR4 antibody for your
CERK antibody
CERK antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.
Purity:Min. 95%ZFP36 antibody
The ZFP36 antibody is a powerful tool used in the field of Life Sciences. It is an antibody that specifically targets and binds to the protein known as ZFP36. This protein plays a crucial role in various cellular processes, including the regulation of gene expression and mRNA stability.RAGE antibody
The RAGE antibody is a glycation-specific polyclonal antibody that targets the receptor for advanced glycation end products (RAGE). This antibody plays a crucial role in various pathological conditions, including thrombotic microangiopathy and atypical hemolytic uremic syndrome. It binds to RAGE and inhibits the interaction between RAGE and its ligands, such as advanced glycation end products (AGEs) and high mobility group box 1 (HMGB1). By blocking this interaction, the RAGE antibody can prevent the activation of downstream signaling pathways involved in inflammation and tissue damage. Additionally, this antibody has been used in research studies to investigate the role of RAGE in various diseases, including cancer and neurodegenerative disorders. The RAGE antibody is available as both monoclonal and polyclonal antibodies, providing researchers with options to suit their specific experimental needs.
Purity:Min. 95%GSTP1 antibody
GSTP1 antibody was raised in Mouse using a purified recombinant fragment of human GSTP1 expressed in E. coli as the immunogen.QTRTD1 antibody
QTRTD1 antibody was raised using the N terminal of QTRTD1 corresponding to a region with amino acids YTKTGSAPHLTHHTLHNIHGVPAMAQLTLSSLAEHHEVLTEYKEGVGKFI
IFN gamma antibody
IFN gamma antibody was raised in mouse using highly pure recombinant human IFN-gamma as the immunogen.TNF alpha antibody
TNF alpha antibody is a glycoprotein that contains sugar moieties and belongs to the epidermal growth factor (EGF)-like family. It acts as a growth factor and plays a crucial role in various biological processes. This antibody specifically targets TNF-α, a pro-inflammatory cytokine involved in immune responses and inflammatory diseases.
UGT2B7 antibody
The UGT2B7 antibody is a powerful tool in Life Sciences research. This antibody has the ability to neutralize fatty acids and EGF-like molecules, making it an essential component in various immunoassays and molecular docking experiments. It exhibits high affinity for human serum albumin and cationic molecules, allowing for precise targeting and detection of specific proteins or chemokines. The UGT2B7 antibody belongs to the class of polyclonal antibodies, ensuring a wide range of binding specificity. With its exceptional performance and versatility, this antibody is a valuable asset for researchers in the field of Life Sciences.
Rabbit anti Mouse IgM
Rabbit anti Mouse IgM is a monoclonal antibody that belongs to the category of antibodies. It is specifically designed to target and bind to mouse IgM, making it an essential tool for various research applications in the field of Life Sciences. This antibody can be used for studying the role of IgM in different biological processes such as anti-VEGF (vascular endothelial growth factor) therapy, adiponectin signaling, β-catenin regulation, and more. Additionally, Rabbit anti Mouse IgM can be utilized for detecting specific proteins like human chorionic gonadotropin (hCG), alpha-synuclein, epidermal growth factor (EGF), c-myc, and glycopeptides. Its binding ability allows researchers to explore these proteins' functions and interactions within cellular pathways. Furthermore, this antibody has been shown to induce Fas-mediated apoptosis in certain experimental settings. With its high specificity and versatility, Rabbit anti Mouse IgM is an invaluable tool for advancing scientificPurity:Min. 95%CRP antibody
CRP antibody was raised using the N terminal of CRP corresponding to a region with amino acids MEKLLCFLVLTSLSHAFGQTDMSRKAFVFPKESDTSYVSLKAPLTKPLKA
PRKAR1A antibody
PRKAR1A antibody is a highly specialized product in the field of Life Sciences. It is an antibody that specifically targets PRKAR1A, a human protein involved in various biochemical processes. This antibody can be used for research purposes, such as studying the role of PRKAR1A in cellular functions and signaling pathways.
G6PD antibody
G6PD antibody was raised in mouse using recombinant human G6PD (35-506aa) purified from E. coli as the immunogen.TACC3 antibody
The TACC3 antibody is a highly specialized monoclonal antibody that has receptor binding capabilities. It acts as a phosphatase, neutralizing specific targets in the body. This antibody is widely used in Life Sciences research and has shown promising results in various studies. It has been found to have an inhibitory effect on alpha-fetoprotein, a protein found in human serum that is associated with certain diseases. The TACC3 antibody can also block the activity of angptl3, a chemokine involved in inflammatory processes. With its immunosuppressant properties, this monoclonal antibody holds great potential for therapeutic applications and further exploration in the field of medicine.
Rat Thymocyte antibody
Rat thymocyte antibody was raised in rabbit using RBC-free rat thymocytes as the immunogen.
Purity:Min. 95%P2X3 antibody
The P2X3 antibody is a monoclonal antibody that has antiestrogen properties. It specifically targets the P2X3 receptor, which is found in adipose tissue and plays a role in various physiological processes. This antibody has been shown to neutralize the activity of the P2X3 receptor, reducing its binding to ligands such as interleukin-6 and natriuretic peptides. By doing so, it can modulate the viscosity of adipose tissue and potentially impact adipocyte function. The P2X3 antibody is also being investigated as a potential therapeutic agent for conditions such as obesity and metabolic disorders. In addition, this antibody can be used in immunoassays for research purposes in the field of life sciences.
GPRC5B antibody
The GPRC5B antibody is a highly specialized protease that plays a crucial role in the field of Life Sciences. It is a monoclonal antibody that specifically targets and interacts with the GPRC5B antigen, which is involved in various biological processes. This antibody has been extensively studied for its potential applications in antiviral therapies, high-flux extracellular chemotherapy, and as an inhibitor in certain disease pathways. The GPRC5B antibody is widely recognized for its exceptional specificity and sensitivity, making it an invaluable tool for researchers and scientists working in the field of antibodies and autoantibodies.
CD27 antibody
The CD27 antibody is a neutralizing monoclonal antibody that targets the CD27 protein. CD27 is a cell surface receptor that plays a crucial role in immune responses and lymphocyte activation. This antibody binds to CD27, preventing its interaction with other molecules and inhibiting downstream signaling pathways. It has been shown to inhibit the activity of glutamate phosphatase and block the production of autoantibodies. The CD27 antibody can be used in various research applications in the field of life sciences, including immunology and cell biology. It is commonly used in experiments involving activated lymphocytes, as well as in studies investigating cytotoxicity and growth factors. This high-quality monoclonal antibody is produced using advanced techniques and has been extensively tested for specificity and functionality. Its purity and reliability make it an excellent choice for researchers seeking accurate and reproducible results.
PIK3R2 antibody
The PIK3R2 antibody is a highly specialized growth factor antibody used in the field of Life Sciences. It belongs to the category of polyclonal antibodies, which are known for their high specificity and sensitivity. This antibody specifically targets the PIK3R2 protein, which plays a crucial role in various cellular processes.
Perilipin (C terminal) antibody
Perilipin (C terminal) antibody was raised in Guinea Pig using C-terminus of perilipin as the immunogen.
Purity:Min. 95%Goat anti Mouse IgG + IgM (H + L) (Texas Red)
Goat anti-mouse IgG/IgM (H+L) was raised in goat using murine IgG and IgM whole molecules as the immunogen.ApoC-I antibody
ApoC-I antibody was raised in goat using full-length recombinant apolipoprotein type C-I produced as the immunogen.Purity:Min. 95%Streptococcus Group A antibody
Streptococcus group A antibody was raised in rabbit using group A Streptococci as the immunogen.
Purity:Min. 95%HBsAg Mouse Monoclonal Antibody
Please enquire for more information about HBsAg Mouse Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page
Purity:Min. 95%Dengue Virus Type 1 Envelope Antigen, Recombinant
Please enquire for more information about Dengue Virus Type 1 Envelope Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page
Purity:Min. 95%Denosumab
CAS:Monoclonal antibody against RANKL; anti-resorptive agent for osteoperosis treatment
Purity:(Sec-Hplc) Min. 95 Area-%Color and Shape:Clear LiquidRef: 3D-BD165585
Discontinued productCA 125 antibody (biotin)
CA 125 antibody (biotin) was raised in mouse using affinity pure human CA 125 antigen as the immunogen.
