Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,721 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(764 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,585 products)
- Metabolism Antibodies(286 products)
- Microbiology Antibodies(741 products)
- Signal Transduction(2,765 products)
- Tags & Cellular Markers(34 products)
Found 75594 products of "Primary Antibodies"
Caspase 8 antibody
The Caspase 8 antibody is a specific monoclonal antibody used for various applications in the field of Life Sciences. It is designed to target and detect caspase 8, an enzyme involved in apoptosis (programmed cell death). This antibody has been extensively tested and validated using human serum samples to ensure its accuracy and reliability.
ATF2 antibody
The ATF2 antibody is a highly specialized product used in the field of Life Sciences. It is available in both polyclonal and monoclonal forms, making it suitable for a wide range of applications. This antibody specifically targets ATF2, a transcription factor involved in various cellular processes such as DNA repair and apoptosis.
p63 antibody
The p63 antibody is a monoclonal antibody that specifically targets the p63 protein. It has been shown to have inhibitory properties against diacylglycerol and interferon, making it a potential therapeutic agent for various diseases. The p63 antibody is also known to inhibit the activity of histidine kinases, which are involved in cell signaling pathways. Additionally, this antibody has cytotoxic effects on cancer cells and can be used as a family kinase inhibitor. It has been shown to interact with β-catenin, a key protein involved in cell adhesion and signaling. The p63 antibody is widely used in Life Sciences research and can be utilized in studies related to epidermal growth factor and glycoprotein signaling pathways. Its unique properties make it a valuable tool for understanding cellular processes and developing new treatments in the field of molecular biology.
Caspase 7 antibody
The Caspase 7 antibody is a powerful inhibitory factor used in Life Sciences research. This polyclonal antibody specifically targets the protein caspase 7, which plays a crucial role in programmed cell death (apoptosis). By blocking the activity of caspase 7, this antibody allows researchers to investigate its function and explore its potential as a therapeutic target.
MTHFR antibody
The MTHFR antibody is a glycosylated glycopeptide that belongs to the class of chemokines. It is used in the field of Life Sciences for various applications, including the detection and quantification of interferon-gamma (IFN-γ) in biological samples. This antibody specifically targets the nuclear protein MTHFR and can be used in experiments such as immunofluorescence and Western blotting. Additionally, it has been shown to have inhibitory effects on factors such as alpha-fetoprotein and β-catenin, making it a valuable tool for studying signal transduction pathways. With its high specificity and affinity, the MTHFR antibody is an essential component for researchers working in the field of molecular biology and cellular signaling.
IFNAR1 antibody
The IFNAR1 antibody is a highly specific monoclonal antibody used in Life Sciences research. It is designed to target and bind to the IFNAR1 protein, which plays a crucial role in the immune response. This antibody has been extensively tested and validated for its efficacy in various applications, including Western blotting, immunoprecipitation, and immunofluorescence.
Mcm7 antibody
The Mcm7 antibody is a cytotoxic monoclonal antibody that belongs to the category of Life Sciences products. It has been specifically designed to target and neutralize the activated form of Mcm7, an inhibitory factor involved in various biological processes. This antibody has been shown to have neuroprotective properties and can inhibit the activity of interleukin-6, a hormone peptide involved in inflammatory responses. Additionally, it has been found to interact with cholinergic receptors and exhibit inhibitory effects on liver microsomes. The Mcm7 antibody is a highly specialized tool for researchers in the field of Life Sciences who are studying the role of Mcm7 in cellular processes and its potential as a therapeutic target.
RB1 antibody
The RB1 antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It is designed to specifically target and neutralize the histidine receptor, which plays a crucial role in various biological processes. This antibody has been extensively studied and proven to be effective in blocking the actions of histidine, thereby modulating its effects on cellular signaling pathways.
ME1 antibody
The ME1 antibody is a monoclonal antibody that targets the ME1 protein. It has been extensively studied in the field of Life Sciences and has shown promising results as a potential family kinase inhibitor. The ME1 antibody specifically binds to the ME1 protein, inhibiting its activity and preventing the activation of growth factors. This antibody has been used in various research studies, including those involving dopamine signaling pathways and cancer cell lines such as MCF-7. In addition, the ME1 antibody can be used in conjunction with other antibodies or inhibitors to study specific cellular processes or pathways. Its specificity and high affinity make it a valuable tool for researchers in the field.
Complement C3 antibody
The Complement C3 antibody is a highly specialized growth factor that plays a crucial role in various biological processes. It is commonly used in research and diagnostic applications. This antibody specifically targets the complement component C3, which is an essential protein involved in the immune response. The Complement C3 antibody is available as both monoclonal and polyclonal antibodies, providing researchers with options based on their specific needs. These antibodies are designed to recognize and bind to different epitopes of the C3 protein, ensuring accurate and reliable results. In addition to its role in the immune system, the Complement C3 antibody has been shown to have antiangiogenic properties. It inhibits endothelial cell growth and angiogenesis, making it a valuable tool for studying these processes. The Complement C3 antibody is widely used in various fields of life sciences research, including immunology, molecular biology, and biochemistry. It can be used in techniques such as Western blotting, immunohistochemistry, flow
Tau antibody
The Tau antibody is a highly specialized product used in the field of Life Sciences. It belongs to the category of Polyclonal Antibodies and is specifically designed to target and neutralize the effects of tau proteins. Tau proteins are known for their involvement in various neurodegenerative diseases, such as Alzheimer's disease.
NCS1 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a highly effective antituberculosis drug that belongs to the class of rifamycins. It is specifically designed to combat tuberculosis infections by targeting the active compounds responsible for the bactericidal activity. This powerful drug inhibits bacterial growth by binding to DNA-dependent RNA polymerase, preventing transcription and replication. Its efficacy has been extensively studied using advanced techniques such as transcription-quantitative polymerase chain and patch-clamp technique. Moreover, it undergoes various metabolic transformations, including hydrolysis by esterases, oxidation by cytochrome p450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it exhibits high affinity towards markers expressed in Mycobacterium tuberculosis strains and effectively inhibits their growth in culture.
Goat anti Syrian Hamster IgG (H + L) (FITC)
Goat anti-syrian hamster IgG (H + L) (FITC) was raised in goat using hamster IgG (H & L) as the immunogen.
RNH1 antibody
RNH1 antibody was raised in mouse using recombinant Ribonuclease inhibitor 1(RNH1) (7-461aa) purified from E. coli as the immunogen.SOX17 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections due to its bactericidal activity. This active compound works by binding to DNA-dependent RNA polymerase, preventing transcription and replication, thus inhibiting bacterial growth. Its efficacy has been demonstrated through extensive research using advanced techniques such as patch-clamp technique on human erythrocytes. The drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed in Mycobacterium tuberculosis strains, inhibiting their growth in culture.
HSP60 antibody
The HSP60 antibody is a polyclonal antibody that is used in Life Sciences research. It specifically targets the acyl-CoA-binding protein (ACBP) and can be used in various immunoassays to detect and measure the levels of ACBP in different samples. ACBP is a glycoprotein that plays a crucial role in fatty acid metabolism and transport within cells. The HSP60 antibody can be used to study the expression and localization of ACBP in different cell types, including human endothelial cells and adipose tissue. It can also be used to investigate the interaction between ACBP and other proteins, such as growth factors, in order to better understand their roles in cellular processes. The HSP60 antibody is available as both polyclonal and monoclonal antibodies, providing researchers with options for their specific experimental needs. Its high specificity and sensitivity make it an invaluable tool for studying the functions of ACBP in cellular biology.
PODXL antibody
PODXL antibody was raised using the N terminal of PODXL corresponding to a region with amino acids TTTVATSTATAKPNTTSSQNGAEDTTNSGGKSSHSVTTDLTSTKAEHLTT
CXCL9 antibody
The CXCL9 antibody is a highly effective monoclonal antibody used in Life Sciences. It is specifically designed to target and neutralize the chemokine CXCL9, which plays a crucial role in various immune responses. This antibody has been extensively tested and proven to have high affinity and specificity for its target.
KCTD11 antibody
KCTD11 antibody was raised using the N terminal of KCTD11 corresponding to a region with amino acids RLGRLDLPRGYGETALLRAEADFYQIRPLLDALRELEASQGTPAPTAALL
GBA antibody
GBA antibody is a highly specific monoclonal antibody that targets molecules involved in necrosis factor-related apoptosis-inducing and growth factor signaling pathways. It binds to specific proteins within the protein complex, effectively neutralizing their activity. This antibody can be used in various applications in Life Sciences, including research and diagnostics. GBA antibody is available as both polyclonal and monoclonal antibodies, providing researchers with options for their specific experimental needs. It has been shown to have high affinity and specificity for its target molecule, making it a valuable tool in studying various biological processes. Additionally, GBA antibody has been tested and validated in human serum samples, ensuring its reliability and accuracy in clinical settings.
CD203c antibody
CD203c antibody is a highly specialized antibody used in the field of Life Sciences. It is designed to target and bind to DNA binding proteins that play a crucial role in various cellular processes. This antibody has been extensively studied and proven to be effective in glycosylation studies, where it helps researchers understand the role of glycosylation in protein function and regulation.
GPR171 antibody
The GPR171 antibody is a highly specialized monoclonal antibody that targets the GPR171 receptor. This receptor plays a crucial role in various biological processes, including erythropoietin signaling, TNF-α production, chemokine regulation, and microvessel density. The GPR171 antibody has been extensively studied and proven to be highly effective in neutralizing the activity of GPR171.
GALNT7 antibody
The GALNT7 antibody is a highly specific polyclonal antibody that targets GALNT7, an enzyme responsible for adding sugar molecules to proteins. This antibody recognizes specific acid residues in GALNT7 and can be used for various applications in life sciences research. It has been extensively validated and shown to have high affinity and specificity for GALNT7.
SARS-CoV-2 Spike Antibody
The SARS-CoV-2 Spike Antibody is a highly effective tool for immunoassays and research in the field of Life Sciences. This antibody specifically targets the spike protein of the SARS-CoV-2 virus, which is responsible for receptor binding and entry into host cells.GAPDH antibody
The GAPDH antibody is a highly effective monoclonal antibody that has been activated to target specific proteins in the body. It is commonly used in Life Sciences research to study various cellular processes and pathways. This antibody has been found to neutralize the activity of TGF-beta, a protein involved in cell growth and differentiation. Additionally, it has shown to have glycosylation properties, which can impact protein function and stability. One of the key targets of the GAPDH antibody is E-cadherin, a protein responsible for cell adhesion and tissue integrity. By binding to E-cadherin, this antibody can modulate cell-cell interactions and potentially influence cellular behavior. Furthermore, studies have demonstrated that the GAPDH antibody can inhibit collagen production, which is crucial for maintaining tissue structure and elasticity. This property may have implications in wound healing and tissue regeneration. Another important aspect of the GAPDH antibody is its ability to regulate microvessel density. By targeting specific proteins involved in angiogenesis, thisgp340 antibody
The gp340 antibody is a highly specialized monoclonal antibody that is designed to target and neutralize specific proteins in the body. It has been extensively tested and proven effective in various research studies conducted by Life Sciences professionals. This antibody specifically targets influenza hemagglutinin, a protein that plays a crucial role in the growth and spread of the influenza virus.
SAR1B antibody
SAR1B antibody was raised using a synthetic peptide corresponding to a region with amino acids RLLESKEELDSLMTDETIANVPILILGNKIDRPEAISEERLREMFGLYGQ
Ibuprofen antibody
The Ibuprofen antibody is a highly specialized monoclonal antibody used in Life Sciences research. It is designed to target and bind specifically to Ibuprofen, a nonsteroidal anti-inflammatory drug commonly used for pain relief and reducing inflammation. This antibody can be used in various assays, including nuclear and GAPDH assays, to detect the presence and levels of Ibuprofen in samples.
FBXO18 antibody
FBXO18 antibody was raised in mouse using recombinant Human F-Box Protein, Helicase, 18 (Fbxo18)TNFSF13 antibody
TNFSF13 antibody was raised in rabbit using the middle region of TNFSF13 as the immunogen
Fibrinogen antibody
Fibrinogen antibody was raised in mouse using fibrin degradation products as the immunogen.RBM39 antibody
RBM39 antibody was raised using the N terminal of RBM39 corresponding to a region with amino acids ADDIDIEAMLEAPYKKDENKLSSANGHEERSKKRKKSKSRSRSHERKRSK
NEDD9 antibody
NEDD9 antibody was raised using the middle region of NEDD9 corresponding to a region with amino acids HPPPQLGQSVGSQNDAYDVPRGVQFLEPPAETSEKANPQERDGVYDVPLH
TSGA13 antibody
TSGA13 antibody was raised using the middle region of TSGA13 corresponding to a region with amino acids ASERPISKVIREPLTLASLLEDMPTRTAPGESAFRNGRAPQWIIKKATVI
hCG beta antibody
The hCG beta antibody is a protein that belongs to the Life Sciences category. It functions by binding to the nuclear factor kappa-light-chain-enhancer in order to regulate gene expression. This antibody is commonly used in research and diagnostic applications, particularly in the field of reproductive health. It has been shown to interact with various proteins, including mitogen-activated protein and β-catenin, which are involved in cellular signaling pathways. Additionally, this antibody has been found to have an inhibitory effect on the activity of p38 mitogen-activated protein phosphatase and caspase-9, both of which play important roles in cell growth and apoptosis. The hCG beta antibody is available as a monoclonal antibody, making it highly specific and reliable for use in experiments and assays requiring precise detection and analysis of target molecules.
GFP antibody (biotin)
GFP antibody (biotin) was raised in goat using a GFP fusion protein corresponding to the full length amino acid sequence (246aa) derived from the jellyfish Aequorea victoria as the immunogen.
MTGR1 antibody
MTGR1 antibody was raised in Rat using MTGR1 peptide couple to carrier protein as the immunogen.
LENG4 antibody
LENG4 antibody was raised using the C terminal Of Leng4 corresponding to a region with amino acids LSAYWHGLHPGYYLSFLTIPLCLAAEGRLESALRGRLSPGGQKAWDWVHW
Leiomodin 1 antibody
Leiomodin 1 antibody was raised using a synthetic peptide corresponding to a region with amino acids SRVAKYRRQVSEDPDIDSLLETLSPEEMEELEKELDVVDPDGSVPVGLRQ
Denosumab
CAS:Monoclonal antibody against RANKL; anti-resorptive agent for osteoperosis treatment
Purity:(Sec-Hplc) Min. 95 Area-%Color and Shape:Clear LiquidRef: 3D-BD165585
Discontinued productHBsAg Mouse Monoclonal Antibody
Please enquire for more information about HBsAg Mouse Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page
Purity:Min. 95%Dengue Virus Type 1 Envelope Antigen, Recombinant
Please enquire for more information about Dengue Virus Type 1 Envelope Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page
Purity:Min. 95%CA 125 antibody (biotin)
CA 125 antibody (biotin) was raised in mouse using affinity pure human CA 125 antigen as the immunogen.
