Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,721 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(764 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,585 products)
- Metabolism Antibodies(286 products)
- Microbiology Antibodies(741 products)
- Signal Transduction(2,765 products)
- Tags & Cellular Markers(34 products)
Found 75594 products of "Primary Antibodies"
PGD antibody
The PGD antibody is a powerful tool used in Life Sciences research. It specifically targets 6-phosphogluconate dehydrogenase (PGD), an enzyme involved in the pentose phosphate pathway. This antibody recognizes and binds to PGD, allowing researchers to study its function and regulation.
Alkaline Phosphatase antibody
Alkaline phosphatase antibody was raised in mouse using human placental alkaline phosphatase as the immunogen.PYCR2 antibody
PYCR2 antibody was raised using the C terminal of PYCR2 corresponding to a region with amino acids LINAVEASCIRTRELQSMADQEKISPAALKKTLLDRVKLESPTVSTLTPS
CHRNB3 antibody
CHRNB3 antibody was raised in rabbit using the middle region of CHRNB3 as the immunogen
Troponin T Type 2 antibody
Troponin T Type 2 antibody was raised using a synthetic peptide corresponding to a region with amino acids ESKPKPRSFMPNLVPPKIPDGERVDFDDIHRKRMEKDLNELQALIEAHFE
PB antibody
PB antibody was raised using the middle region of Pb corresponding to a region with amino acids DLTERQVKVWFQNRRMKHKRQTLSKTDDEDNKDSLKGDDDQSDSNSNSKK
TRIM32 antibody
The TRIM32 antibody is a highly specialized antibody used in the field of Life Sciences. It is designed to specifically target and bind to the TRIM32 protein, which is an important molecule involved in various cellular processes. This polyclonal antibody is produced by immunizing animals with the target molecule, resulting in a diverse range of antibodies that can recognize different epitopes on TRIM32.
SLC7A8 antibody
SLC7A8 antibody was raised using a synthetic peptide corresponding to a region with amino acids PRAIFISIPLVTFVYVFANVAYVTAMSPQELLASNAVAVTFGEKLLGVMA
GJA9 antibody
GJA9 antibody was raised using the middle region of GJA9 corresponding to a region with amino acids IDGENNMRQSPQTVFSLPANCDWKPRWLRATWGSSTEHENRGSPPKGNLK
Purity:Min. 95%CD11b antibody (Spectral Red)
CD11b antibody (PE) was raised in rat using C57BL/10 murine splenic T-cells and concanavalin A-activted C57BL/10 splenocytes as the immunogen.
Purity:Min. 95%METTL2B antibody
METTL2B antibody was raised using the N terminal of METTL2B corresponding to a region with amino acids INAHKYWNDFYKIHENGFFKDRHWLFTEFPELAPSQNQNHLKDWFLENKS
Factor VIII antibody
Factor VIII antibody is a monoclonal antibody that targets sclerostin, an epidermal growth factor. It is commonly used in Life Sciences research as a tool to study the role of sclerostin in bone metabolism and growth. This antibody has been shown to be highly specific and effective in neutralizing the activity of sclerostin, leading to increased bone formation and density. Factor VIII antibody can also be used as a cytotoxic agent in certain applications, such as targeted therapy for cancer cells that express high levels of sclerostin. Additionally, this antibody can be conjugated to various biomaterials or used in combination with other antibodies for specific research purposes. Its unique properties make it a valuable tool for studying the effects of sclerostin on bone health and development.
KSHV K8 alpha antibody
KSHV K8 alpha antibody was raised in Mouse using a purified recombinant fragment of KSHV K8alpha expressed in E. coli as the immunogen.HS3ST5 antibody
HS3ST5 antibody was raised using a synthetic peptide corresponding to a region with amino acids SQYNLYFNATRGFYCLRFNIIFNKCLAGSKGRIHPEVDPSVITKLRKFFH
Purity:Min. 95%Goat anti Rat IgG (H + L) (FITC)
This antibody reacts with heavy (gamma) chains on rat IgG and light chains on all rat immunoglobulins.
Purity:Min. 95%proBNP antibody
The proBNP antibody is a monoclonal antibody that specifically targets and inhibits the activity of proBNP, an important biomarker for heart failure. This antibody has been extensively studied and shown to effectively neutralize proBNP in human serum samples, making it a valuable tool in cardiovascular research and diagnostics. By blocking the binding of proBNP to its receptor, this antibody can help regulate the levels of this peptide hormone, which plays a crucial role in fluid balance and cardiac function. Additionally, the proBNP antibody has potential applications in therapeutic interventions for heart failure and other related conditions. Its specificity and high affinity make it an ideal candidate for further investigation in the field of cardiology and life sciences.
CD3e antibody (FITC)
CD3e antibody (FITC) was raised in mouse using porcine CD3e as the immunogen.
Purity:Min. 95%PNPLA3 antibody
PNPLA3 antibody was raised using the C terminal of PNPLA3 corresponding to a region with amino acids CSPKGCPAETKAEATPRSILRSSLNFFLGNKVPAGAEGLSTFPSFSLEKS
Factor V antibody
Factor V antibody was raised in sheep using human factor V purified from plasma as the immunogen.
SP1 antibody
The SP1 antibody is a glycoprotein inhibitor that is pegylated and classified as a monoclonal antibody. It is commonly used in Life Sciences research and has various applications. The SP1 antibody has been found to be effective in neutralizing the activity of trastuzumab, an antibody used in the treatment of breast cancer. Additionally, it has shown potential as a therapeutic agent for targeting specific growth factors, such as glucagon and fatty acid receptors. This antibody exhibits cytotoxic properties and can inhibit the growth of cancer cells by blocking essential cellular processes. Furthermore, the SP1 antibody has been utilized in studies involving glutamate receptors and has proven to be valuable in understanding their functions. Overall, this highly specialized antibody offers great potential for researchers seeking to investigate various biological pathways and targets within the human body.
Purity:Min. 95%ADA antibody
ADA antibody was raised using the middle region of ADA corresponding to a region with amino acids ANYSLNTDDPLIFKSTLDTDYQMTKRDMGFTEEEFKRLNINAAKSSFLPEPurity:Min. 95%Na+ Ca2+ Exchanger antibody (cardiac)
Na+ Ca2+ exchanger antibody (cardiac) was raised in rabbit using canine cardiac sarcolemma Na+/Ca2+ exchanger as the immunogen.
FBXL5 antibody
FBXL5 antibody was raised using the middle region of FBXL5 corresponding to a region with amino acids VHWARGDWYSGPATELDTEPDDEWVKNRKDESRAFHEWDEDADIDESEES
CD24 antibody (Spectral Red)
CD24 antibody (Spectral Red) was raised in rat using murine heat stable antigen as the immunogen.
Purity:Min. 95%PKC alpha antibody
The PKC alpha antibody is a highly specialized antibody that targets the protein kinase C alpha (PKCα) enzyme. It is commonly used in life sciences research to study various cellular processes and signaling pathways. This monoclonal antibody specifically binds to the activated form of PKCα, allowing researchers to detect and analyze its activity in different cell types.
MCP4 antibody
MCP4 antibody was raised in mouse using highly pure recombinant human MCP-4 as the immunogen.
Cystatin C antibody
The Cystatin C antibody is a highly specialized antibody that is used in various applications in the field of Life Sciences. This polyclonal antibody specifically targets cystatin C, an anticoagulant protein that plays a crucial role in regulating protease activity. The Cystatin C antibody is widely used in research and diagnostic laboratories for the detection and quantification of cystatin C levels in biological samples.
Purity:Min. 95%Goat anti Mouse IgG (H + L)
This antibody reacts with heavy (gamma) chains on mouse IgG and light chains on all mouse immunoglobulins.Purity:Min. 95%FSH antibody
FSH antibody was raised in mouse using high purity intact FSH from human pituitary gland as the immunogen.
EGFR antibody
The EGFR antibody is a highly effective growth factor that targets the c-myc protein. It is available in both polyclonal and monoclonal forms, offering versatility in its applications. This cytotoxic antibody has been extensively studied and proven to be effective in various assays, including the inhibition of human chorionic gonadotropin (hCG) and anti-VEGF assays. The EGFR antibody specifically targets nuclear glycoproteins, making it an ideal choice for research involving inhibitors and other nuclear-related studies. With its high specificity and potency, this monoclonal antibody is a valuable tool for researchers in the field of molecular biology and beyond.
RALA antibody
The RALA antibody is a glycopeptide that acts as an anticoagulant by neutralizing the viscosity of fibrinogen. It belongs to the class of peptide agents known as antibodies, which are widely used in Life Sciences research. This antibody specifically binds to glycan-binding proteins and has been shown to have toxic effects on various cell types. Additionally, it has been found to inhibit the activity of colony-stimulating factors such as interleukin-6, making it a valuable tool for studying immune responses and cell signaling pathways. The RALA antibody is a polyclonal antibody, meaning it recognizes multiple epitopes on its target protein, increasing its versatility in experimental applications.
OR51E2 antibody
The OR51E2 antibody is a highly specialized monoclonal antibody that is used in various Life Sciences applications. This antibody specifically targets and interacts with the OR51E2 protein, which plays a crucial role in cellular processes such as cell growth, proliferation, and differentiation.
Endothelin 1 antibody
The Endothelin 1 antibody is a highly specialized product in the field of Life Sciences. It falls under the category of Antibodies and has proven to be effective in various applications such as electrophoresis and colloidal techniques. This antibody specifically targets the epidermal growth factor, which is a crucial growth factor involved in many biological processes.
Glycoprotein Ib antibody
Glycoprotein Ib antibody was raised using a synthetic peptide corresponding to a region with amino acids RGSLPTFRSSLFLWVRPNGRVGPLVAGRRPSALSQGRGQDLLSTVSIRYS
Purity:Min. 95%CD71 antibody (Azide Free)
CD71 antibody (Azide free) was raised in rat using CD71/transferrin receptor as the immunogen.
CITED4 antibody
CITED4 antibody was raised in rabbit using the N terminal of CITED4 as the immunogenPurity:Min. 95%PRSS16 antibody
PRSS16 antibody was raised using a synthetic peptide corresponding to a region with amino acids SHSTPYCGLRRAVQIVLHSLGQKCLSFSRAETVAQLRSTEPQLSGVGDRQ
Purity:Min. 95%Goat anti Human IgG (H + L) (rhodamine)
This antibody reacts with heavy chains on human IgG (gamma chain) and light chains on all human immunoglobulins.
Purity:Min. 95%PCNP antibody
The PCNP antibody is a highly specialized and versatile product used in the field of Life Sciences. This antibody is derived from adeno-associated virus and has been pegylated for enhanced stability and efficacy. It specifically targets actin filaments, which play a crucial role in various cellular processes.
Goat anti Human IgG (HRP)
This antibody reacts with heavy chains on human IgG (gamma chain).Purity:Min. 95%PCT monoclonal antibody
The PCT monoclonal antibody is a cutting-edge product in the field of Life Sciences. It is specifically designed to target and bind to hepatocyte growth factor, making it a valuable tool for research and diagnostic purposes. This monoclonal antibody is produced by hybridoma cells, ensuring high specificity and purity. The PCT monoclonal antibody has been extensively tested and validated for its effectiveness in various applications, including immunohistochemistry, Western blotting, and ELISA assays. Its unique glycosylation pattern ensures optimal performance and stability. This versatile antibody can be used to study the activation of creatine kinase, antibodies against collagen, apical membrane proteins, human folate receptors, and phosphatase activity. With its exceptional quality and reliability, the PCT monoclonal antibody is an essential tool for researchers in the field of Life Sciences.NOX1 antibody
The NOX1 antibody is a highly specialized polyclonal antibody that targets the oncostatin receptor. It is designed to specifically bind to glial fibrillary acidic protein (GFAP), an antigen expressed in glial cells. This antibody can be used for various applications, including immunohistochemistry and western blotting, to detect the presence and localization of GFAP in tissues or cell cultures.
SLPI antibody
SLPI antibody was raised in rabbit using the N terminal of SLPI as the immunogen
Purity:Min. 95%LGALS3 antibody
LGALS3 antibody was raised using the N terminal of LGALS3 corresponding to a region with amino acids GASYPGAYPGQAPPGAYPGQAPPGAYPGAPGAYPGAPAPGVYPGPPSGPG
Dengue Virus Type 1 Envelope Antigen, Recombinant
Please enquire for more information about Dengue Virus Type 1 Envelope Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page
Purity:Min. 95%HBsAg Mouse Monoclonal Antibody
Please enquire for more information about HBsAg Mouse Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page
Purity:Min. 95%Denosumab
CAS:Monoclonal antibody against RANKL; anti-resorptive agent for osteoperosis treatment
Purity:(Sec-Hplc) Min. 95 Area-%Color and Shape:Clear LiquidRef: 3D-BD165585
Discontinued productCA 125 antibody (biotin)
CA 125 antibody (biotin) was raised in mouse using affinity pure human CA 125 antigen as the immunogen.
