Primary Antibodies

Rabbit polyclonal NOC2 antibody

A Mouse Monoclonal Antibody complementary to recombinant Chikungunya envelope 1 (E1) and 2 (E2) proteins, which is available as the immunoglobulin subclass IgG1. The product has been purified by ion exchange chromatography and is presented as a liquid in 0.015M potassium phosphate, 0.85% NaCl, pH 7.2.
Transmitted by mosquito vectors, Chikungunya is a positive-stranded RNA, alpha virus infecting human musculoskeletal tissues. The two glycoproteins E1 and E2 of the Chikungunya virus, to which this Mab is complementary, are responsible for viral entry into host cells and both contain a transmembrane domain. Furthermore E2 has the three globular domains A, B and C which are linked by a β-ribbon connector region. While E2 is essential for mediating viral attachment, E1’s β-sheet structure and class II viral glycoproteins: DI, DII and DIII domains enable the virus to fuse with the host’s membrane. This primarily occurs through the insertion of the DII domain’s fusion loop into the host’s cell membrane.
Together E1 and E2 form a viral spike protein which when binding with high affinity to host alphavirus receptors such as Mxra8, allow this receptor to be inserted into E1 and E2. This results in Mxra8 contact between E2’s A and B domains and E1’s fusion loop. Neutralising antibodies can target these domains, in particular A and B domains within E2, hence preventing viral attachment to host cells. Consequently this antibody could be used to investigate possible treatments to combat Chikungunya virus. Another potential application of this product could be used in antibody and antigen interaction dependent assays to detect the presence of the Chikungunya virus.

Affinity purified Rabbit polyclonal SEPT7 antibody

The Glucagon antibody is a powerful tool in the field of medical research and diagnostics. This antibody specifically targets glucagon, an important hormone involved in regulating blood sugar levels. It has been extensively studied and characterized for its ability to bind to glucagon with high affinity and specificity.

Affinity purified Rabbit polyclonal KHS antibody

Rabbit polyclonal Mevalonate Kinase antibody

C4BPA antibody was raised in Rabbit using Human C4BPA as the immunogen

Rbm3 antibody was raised in rabbit using the N terminal of Rbm3 as the immunogen

The TFF1 antibody is a highly specific monoclonal antibody that targets the glutamate receptor. It has cytotoxic properties and can effectively neutralize autoantibodies in the body. The TFF1 antibody is designed to specifically bind to reactive antibodies, preventing them from causing harm to healthy cells. Additionally, this antibody has been shown to inhibit the activity of β-catenin, a protein involved in cell adhesion and signaling pathways.

Rabbit polyclonal CBX6 antibody

MIF antibody is a monoclonal antibody that has anticoagulant properties. It belongs to the group of antibodies known as cytotoxic antibodies. This antibody specifically targets and neutralizes the inhibitory factor known as MIF (Migration Inhibitory Factor). MIF is a protein involved in various biological processes, including immune response and inflammation. The MIF antibody can bind to MIF and prevent its activity, which may have therapeutic implications in certain diseases.

KIDINS220 antibody was raised in Rabbit using Human KIDINS220 as the immunogen

Rabbit polyclonal CSNK2B antibody

HBeAg antibody was raised in mouse using purified HBeAg as the immunogen.

Affinity purified Rabbit polyclonal GLYCTK antibody

The Ku70 antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It targets and inhibits the activity of hepatocyte growth factor, a key growth factor involved in various cellular processes. This antibody can be used for research purposes to study the role of hepatocyte growth factor in different biological systems.

IKZF3 antibody was raised in Rabbit using Human IKZF3 as the immunogen

Rabbit polyclonal SYCE1 antibody

Affinity purified Rabbit polyclonal FLRT1 antibody

APOH antibody was raised in Rabbit using Human APOH as the immunogen

Affinity purified Rabbit polyclonal PASK antibody

The Tau antibody is a highly specialized product used in the field of Life Sciences. It belongs to the category of Polyclonal Antibodies and is specifically designed to target and neutralize the effects of tau proteins. Tau proteins are known for their involvement in various neurodegenerative diseases, such as Alzheimer's disease.

Armenian Hamster monoclonal CD48 antibody (biotin)

Affinity purified Rabbit polyclonal GCM2 antibody

EphB1 antibody was raised in Mouse using a purified recombinant fragment of EphB1(aa19-133) expressed in E. coli as the immunogen.

Purified Rabbit polyclonal FBPA antibody

The ASF1A antibody is a highly specific monoclonal antibody that targets the activated form of ASF1A, a phosphatase involved in various cellular processes. This antibody is colloidal in nature, allowing for easy dispersion and effective targeting of ASF1A. It has been extensively studied for its pharmacodynamics and has shown promising results as a potential medicament in the treatment of certain diseases.

FSCN3 antibody was raised in Rabbit using Human FSCN3 as the immunogen

AGPAT6 antibody was raised in Rabbit using Human AGPAT6 as the immunogen

Rabbit polyclonal TIMM9 antibody

The GAD67 antibody is a pegylated polyclonal antibody that specifically targets glutamate decarboxylase 67 (GAD67). It is commonly used in life sciences research to study the expression and function of GAD67. The antibody can be used in various applications such as immunohistochemistry, Western blotting, and enzyme-linked immunosorbent assay (ELISA).

Rabbit polyclonal AP2S1 antibody (FITC)

The Myc antibody is a highly specialized monoclonal antibody that targets and neutralizes the growth factor interleukin-6 (IL-6). IL-6 is known to play a crucial role in various biological processes, including cell proliferation and cytotoxicity. By specifically binding to IL-6, the Myc antibody effectively inhibits its activity, preventing excessive cell growth and promoting a balanced cellular environment.

NDUFS8 antibody was raised in rabbit using the C terminal of NDUFS8 as the immunogen

Purified Polyclonal PKAC alpha/beta antibody

Rabbit polyclonal argF antibody (HRP)

Affinity purified Rabbit polyclonal Tetraspan 1 antibody

Rabbit polyclonal SCYE1 antibody

The RICTOR antibody is a highly specialized nuclear receptor that plays a crucial role in various cellular processes. This polyclonal antibody is designed to target specific proteins and molecules involved in the regulation of insulin signaling pathways. It can be used for a wide range of applications, including immunohistochemistry, western blotting, and flow cytometry.

GLRA1 antibody was raised in rabbit using the middle region of GLRA1 as the immunogen

ADAP2 antibody was raised in Rabbit using Human ADAP2 as the immunogen

Affinity purified Rabbit polyclonal PRPSAP2 antibody

The TUB antibody is a monoclonal antibody that specifically targets the nuclear protein known as TUB. This antibody has been extensively tested and is proven to be highly effective in detecting TUB in human serum and MCF-7 cells. TUB is a crucial protein involved in various cellular processes, including hormone peptide synthesis, glucagon regulation, and tyrosine metabolism. Additionally, this antibody can be used in research applications such as immunohistochemistry and western blotting. Its high specificity and sensitivity make it a valuable tool for studying TUB-related diseases and exploring potential therapeutic interventions. Furthermore, the TUB antibody can be used in combination with other antibodies, such as anti-CD20 antibodies or alpha-fetoprotein antibodies, to enhance its detection capabilities. With its wide range of applications and reliable performance, the TUB antibody is an essential tool for researchers studying proteins involved in cellular signaling pathways, glycoprotein synthesis, amyloid plaque formation, and chemokine regulation.

Rabbit polyclonal NUTF2 antibody

MTO1 antibody was raised in Rabbit using Human MTO1 as the immunogen

GBA antibody is a highly specific monoclonal antibody that targets molecules involved in necrosis factor-related apoptosis-inducing and growth factor signaling pathways. It binds to specific proteins within the protein complex, effectively neutralizing their activity. This antibody can be used in various applications in Life Sciences, including research and diagnostics. GBA antibody is available as both polyclonal and monoclonal antibodies, providing researchers with options for their specific experimental needs. It has been shown to have high affinity and specificity for its target molecule, making it a valuable tool in studying various biological processes. Additionally, GBA antibody has been tested and validated in human serum samples, ensuring its reliability and accuracy in clinical settings.

Rabbit polyclonal KAD1 antibody

The Adiponectin antibody is a monoclonal antibody that specifically targets and inhibits the formation of adiponectin, a protein found in human serum. Adiponectin plays a crucial role in regulating insulin sensitivity and lipid metabolism, making it an important target for research in the field of Life Sciences. This antibody effectively blocks the interaction between adiponectin and its receptors, preventing downstream signaling pathways involved in hepatic steatosis and interferon production. By inhibiting the formation of TGF-β1, the Adiponectin antibody also has potential therapeutic applications in conditions such as ischemia-reperfusion injury. The high specificity and affinity of this monoclonal antibody ensure reliable results in antigen-antibody reactions. It can be used in various techniques, including particle reactions and cellulose-based assays. Researchers can rely on its performance to accurately detect and quantify adiponectin levels in different biological samples. Overall, the Adiponectin antibody

The SFTPD antibody is a substance that belongs to the group of antibodies. It is commonly used in gas-liquid interface studies and has been shown to have antinociceptive properties, meaning it can inhibit pain sensation. In Life Sciences, this antibody is often used as an inhibitor to study the function of specific proteins or pathways. Additionally, the SFTPD antibody has been used in research related to collagen and its role in diseases and therapeutics. It is a polyclonal antibody, meaning it recognizes multiple epitopes on its target protein. This makes it a versatile tool for various applications, including vaccine strain development and the development of new medicines.

The Aggrecan antibody is a highly effective neutralizing agent used in the field of Life Sciences. This antibody is specifically designed to target and inhibit the activity of aggrecan, a growth factor that plays a crucial role in various biological processes. It has been extensively studied for its potential applications in mesenchymal stem cell research, as well as its ability to modulate TGF-beta signaling pathways.

Rabbit polyclonal ABL1 antibody (Tyr412)

Purified Goat anti-human Eotaxin polyclonal antibody

Rabbit polyclonal WRKY27.1 antibody

Rabbit polyclonal Adrenergic Receptor alpha 2A antibody

The Albendazole antibody is a highly specialized product used in the field of Life Sciences. It belongs to the category of Polyclonal Antibodies and monoclonal antibodies, which are widely used as inhibitors in various research applications. This antibody specifically targets endothelial growth factor, making it a valuable tool for studying angiogenesis and related processes.

Calcitonin antibody is a powerful tool used in life sciences research and diagnostics. It is a type of polyclonal antibody that specifically targets the growth hormone receptor. This antibody recognizes and binds to the receptor, blocking its activity and preventing the binding of growth hormone.

Sheep polyclonal Ketoprofen antibody

Affinity purified Rabbit polyclonal Human NFKB p65 antibody

The AML1 antibody is a highly specialized Polyclonal Antibody used in immunosuppressant therapies. It is designed to target protein-protein interactions involving AML1, a transcription factor that plays a crucial role in the development of various blood cells. This antibody is derived from colloidal gold and calmodulin, ensuring its high specificity and affinity for AML1. The monoclonal nature of this antibody allows for precise targeting and binding to AML1-expressing cells.

Rabbit polyclonal VOPP1 antibody (FITC)

The Listeria antibody is a polyclonal antibody that is used in Life Sciences research. It is commonly used in assays to detect the presence of Listeria monocytogenes, a bacterium that can cause serious infections in humans. This antibody specifically binds to nuclear antigens expressed by Listeria, allowing for easy detection and identification. The Listeria antibody is highly specific and sensitive, making it an essential tool for researchers studying this pathogen. It can be used in various applications, including immunohistochemistry, Western blotting, and ELISA assays. With its high affinity and specificity, the Listeria antibody provides accurate and reliable results in detecting Listeria monocytogenes in samples such as human serum or colloidal suspensions. Researchers rely on this powerful tool to advance their understanding of Listeria infection and develop effective treatments.

Tetanus toxin antibody is a monoclonal antibody that specifically targets and neutralizes the tetanus toxin. This antibody is derived from alpha-fetoprotein and has been extensively studied in the field of Life Sciences. It binds to the tetanus toxin, preventing it from binding to its target receptors and exerting its toxic effects. Additionally, this antibody has been shown to inhibit the activity of TGF-beta, a growth factor involved in various cellular processes. The binding proteins present in this antibody can effectively block the interaction between TGF-beta and its receptors, leading to the inhibition of downstream signaling pathways. Furthermore, studies have demonstrated that this monoclonal antibody can also bind to autoantibodies and other proteins involved in disease progression. With its high specificity and efficacy, tetanus toxin antibody holds great potential for therapeutic applications in various medical conditions.

The proGRP antibody is a highly specialized antibody used in the field of Life Sciences. It is designed to specifically target and immobilize the proGRP protein, which plays a crucial role in various biological processes. This antibody is produced using both monoclonal and polyclonal antibodies, ensuring high specificity and sensitivity.

ACTRT1 antibody was raised using the middle region of ACTRT1 corresponding to a region with amino acids DTDIQNKLYADIVLSGGTTLLPGLEERLMKEVEQLASKGTPIKITASPDR

The WAS antibody is a polyclonal antibody used in life sciences research. It specifically targets the antigen-binding domain of the Wiskott-Aldrich syndrome (WAS) protein. This antibody is commonly used to detect protein carbonyls and has been extensively validated for use in various experimental settings. The WAS antibody is available as both monoclonal and polyclonal preparations, with the polyclonal form being particularly useful for neutralizing experiments. It can be used in a range of applications, including Western blotting, immunohistochemistry, and immunofluorescence. Additionally, this antibody has shown potential in studies involving polypeptide expression, anti-dnp antibodies, growth factors, caspase-9 signaling pathways, cholinergic systems, and bioassays. Researchers can rely on the high quality and specificity of the WAS antibody to advance their scientific investigations.

Mouse monoclonal BCAR1 antibody

Rabbit polyclonal USP49 antibody

HMG20B antibody was raised in Rabbit using Human HMG20B as the immunogen

The Influenza A antibody is a highly effective monoclonal antibody that targets the growth factor of the influenza virus. This antibody specifically binds to extracellular proteins of the virus, preventing its attachment and entry into host cells. By neutralizing the virus, it helps to inhibit viral replication and spread within the body.

The PFKL antibody is an activated antibody that specifically targets the racemase enzyme. It is commonly used in Life Sciences research and assays to study the role of this enzyme in various biological processes. The PFKL antibody is available as both a polyclonal antibody and a monoclonal antibody, providing researchers with options for their specific experimental needs. This antibody can be used for a range of applications, including immunohistochemistry, Western blotting, and ELISA. Its high specificity and sensitivity make it a valuable tool for detecting and quantifying the presence of racemase in samples such as human serum or extracellular fluids. Additionally, the PFKL antibody can be used in combination with other cytotoxic inhibitors or antibodies to study complex signaling pathways or protein interactions. Whether you are conducting basic research or developing new diagnostic tools, the PFKL antibody is an essential component for your experiments.

Mouse monoclonal TPMT antibody

The SAE1 antibody is a powerful tool used in the field of Life Sciences. It is a monoclonal antibody that specifically targets the SAE1 protein, which plays a crucial role in various cellular processes. This antibody has been extensively studied and proven to be highly effective in detecting and quantifying SAE1 protein levels.

Rabbit polyclonal VASH1 antibody

Rabbit polyclonal PDHX antibody

The HES2 antibody is a polyclonal antibody that specifically targets the serum albumin protein. It has cytotoxic properties and is widely used in Life Sciences research. The HES2 antibody has been shown to interact with various proteins, including angptl3, e-cadherin, taxol, β-catenin, and osteopontin. It is commonly used in experiments involving hybridization and activated human serum. This antibody is highly effective in detecting and analyzing specific proteins in biological samples, making it an essential tool for researchers in various fields.

Affinity purified Rabbit polyclonal TAAR5 antibody

The ALPK1 antibody is a highly specific monoclonal antibody that targets the ALPK1 protein. This protein plays a crucial role in various cellular processes, including oncostatin signaling and β-catenin activation. The ALPK1 antibody has been extensively tested and validated for its specificity, ensuring accurate and reliable results in experiments.

p16 antibody was raised in mouse using recombinant p16 as the immunogen.

ZNF335 antibody was raised in rabbit using the middle region of ZNF335 as the immunogen

Please enquire for more information about HBsAg Mouse Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page

Please enquire for more information about Dengue Virus Type 1 Envelope Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page

Monoclonal antibody against RANKL; anti-resorptive agent for osteoperosis treatment

CA 125 antibody (biotin) was raised in mouse using affinity pure human CA 125 antigen as the immunogen.

Cortisol antibody was raised in mouse using cortisol-3 BSA as the immunogen.