Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,721 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(764 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,585 products)
- Metabolism Antibodies(286 products)
- Microbiology Antibodies(741 products)
- Signal Transduction(2,765 products)
- Tags & Cellular Markers(34 products)
Found 75594 products of "Primary Antibodies"
TBRG4 antibody
The TBRG4 antibody is an antigen-specific antibody that is used in Life Sciences research. It is a polyclonal antibody that specifically targets TBRG4, a protein involved in various cellular processes. This antibody has been widely used in studies related to alpha-fetoprotein, natriuretic peptides, and albumin. It can be used in both monoclonal and polyclonal forms, depending on the specific research needs. The TBRG4 antibody has shown high specificity and sensitivity when used in assays such as ELISA and Western blotting. It has also been used to detect TBRG4 expression in human serum samples and to study its role in interferon signaling and growth factor regulation.
FARS2 antibody
FARS2 antibody was raised using the N terminal of FARS2 corresponding to a region with amino acids VELLGKSYPQDDHSNLTRKVLTRVGRNLHNQQHHPLWLIKERVKEHFYKQ
RPE antibody
RPE antibody was raised using the middle region of RPE corresponding to a region with amino acids MMVSKPEQWVKPMAVAGANQYTFHLEATENPGALIKDIRENGMKVGLAIK
RGS2 antibody
The RGS2 antibody is a powerful tool in the field of Life Sciences. This antibody is designed to target and inhibit the activity of RGS2, a protein involved in various cellular processes. By binding to RGS2, this antibody effectively blocks its function, leading to a cascade of downstream effects.
Claudin 17 antibody
Claudin 17 antibody was raised using the middle region of CLDN17 corresponding to a region with amino acids KQVQCTGSNERAKAYLLGTSGVLFILTGIFVLIPVSWTANIIIRDFYNPA
NOD2 antibody
The NOD2 antibody is a highly specialized protein used in the field of Life Sciences. It acts as an inhibitory factor for growth factors such as epidermal growth factor and hepatocyte growth factor. This monoclonal antibody specifically targets NOD2, a receptor involved in immune responses and inflammation. By binding to NOD2, the antibody blocks its function and prevents the activation of downstream signaling pathways. This antibody has been extensively studied and shown to be effective in various research applications, including the study of autoimmune diseases, cancer biology, and immunology. Whether you need a polyclonal or monoclonal antibody, our high-quality NOD2 antibodies are reliable tools for your research needs.
Ibuprofen antibody
The Ibuprofen antibody is a highly specialized antibody that targets and binds to Ibuprofen, a popular nonsteroidal anti-inflammatory drug (NSAID). This antibody has been extensively studied in the field of Life Sciences and has shown promising results in various research applications.
GPR45 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is specifically designed to combat tuberculosis infection by targeting the active compounds responsible for its growth. This bactericidal activity is achieved by binding to DNA-dependent RNA polymerase, effectively preventing transcription and replication. Extensive research has been conducted using advanced techniques like transcription-quantitative polymerase chain and patch-clamp technique to confirm its high efficacy on human erythrocytes. Metabolically, this drug undergoes various transformations including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it exhibits a strong affinity for markers expressed in Mycobacterium tuberculosis strains, inhibiting their growth in culture. Experience the power of 6-Fluoro
UBE1 antibody
The UBE1 antibody is a highly specialized antibody that targets the ubiquitin-activating enzyme 1 (UBE1). This enzyme plays a crucial role in the process of protein degradation by attaching ubiquitin molecules to target proteins. The UBE1 antibody specifically recognizes and binds to UBE1, inhibiting its activity and preventing the degradation of target proteins.
CD4a antibody (PE)
CD4a antibody (PE) was raised in mouse using CD4a as the immunogen.
Purity:Min. 95%Molecular weight:0 g/molInfluenza A antibody (FITC)
Influenza A antibody (FITC) was raised in mouse using Influenza A nucleoprotein as the immunogen.
Purity:Min. 95%MVD antibody
The MVD antibody is a highly specialized product in the field of Life Sciences. It is a monoclonal antibody that has been developed using cutting-edge technology. This antibody specifically targets and binds to collagen, making it an essential tool for research and diagnostic purposes.
Archain 1 antibody
Archain 1 antibody was raised using the middle region of ARCN1 corresponding to a region with amino acids GGLQNMELHGMIMLRISDDKYGRIRLHVENEDKKGVQLQTHPNVDKKLFT
Mad2L1 antibody
Mad2L1 antibody is a highly specific monoclonal antibody that targets Mad2L1 protein. Mad2L1 is involved in various cellular processes, including cell cycle regulation and checkpoint control. This antibody can be used for research purposes in the field of Life Sciences to study the role of Mad2L1 in different biological pathways.
PFK antibody
The PFK antibody is a highly specialized polymerase enzyme that acts as a neutralizing agent. It is a monoclonal antibody specifically designed to target collagen and inhibit its activity. This antibody has shown great potential in the field of Life Sciences, particularly in research related to TGF-beta1, albumin, phosphatase, growth factors, interferon, glutamate, and dopamine. Its unique mechanism of action makes it an invaluable tool for studying various biological processes and pathways. Whether you're conducting experiments or exploring new therapeutic avenues, the PFK antibody is sure to be an asset in your scientific endeavors.
SAMHD1 antibody
The SAMHD1 antibody is a highly specialized tool used in various assays and research applications. It specifically targets SAMHD1, an EGF-like glycoprotein involved in cellular processes. This antibody is designed to inhibit the activity of SAMHD1 and can be used as a valuable tool for studying its function.
SLUG antibody
The SLUG antibody is a monoclonal antibody that specifically targets a molecule called SLUG. It has cytotoxic properties, meaning it can kill cells that express SLUG. This antibody has been extensively studied and shown to be effective in various applications.
Goat anti Human IgG (rhodamine)
This antibody reacts with heavy chains on human IgG (gamma chain).
Purity:Min. 95%ZNF624 antibody
ZNF624 antibody was raised in rabbit using the middle region of ZNF624 as the immunogen
Purity:Min. 95%APCS antibody
APCS antibody was raised using the N terminal of APCS corresponding to a region with amino acids NFTLCFRAYSDLSRAYSLFSYNTQGRDNELLVYKERVGEYSLYIGRHKVT
GLUT4 antibody
The GLUT4 antibody is a polyclonal antibody used in the life sciences field. It specifically targets binding proteins involved in the regulation of glucose transport. This antibody has been extensively tested and validated for its specificity and sensitivity. It has been shown to effectively detect GLUT4 expression in various tissues and cell types.
CD45.2 antibody (biotin)
CD45.2 antibody (biotin) was raised in mouse using CD45.2 as the immunogen.
Purity:Min. 95%Molecular weight:0 g/molCD45.1 antibody (Allophycocyanin-CY7)
CD45 antibody (Allophycocyanin) was raised in Rat using CD45/LCA as the immunogen.
Purity:Min. 95%Rabbit anti Mouse IgG (H + L)
This antibody reacts with heavy (gamma) chains on rabbit IgG and light chains on all rabbit immunoglobulins.Purity:Min. 95%IFITM1 antibody
The IFITM1 antibody is a chemokine that plays a crucial role in immune response modulation. It is a polyclonal antibody that specifically targets the proprotein encoded by the IFITM1 gene. This antibody can be used for various applications in life sciences, including research and diagnostic purposes.
CD4 antibody
The CD4 antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It acts as an inhibitor, targeting coagulation factors and other active agents involved in various biological processes. This monoclonal antibody specifically binds to nuclear antigens, making it an effective tool for research and diagnostic purposes.
Keratin K4 antibody
Keratin K4 antibody was raised in Guinea Pig using synthetic peptide of human keratin K4 coupled to KLH as the immunogen.
Purity:Min. 95%ST3GAL4 antibody
ST3GAL4 antibody was raised using the middle region of ST3GAL4 corresponding to a region with amino acids IKQKPTTGLLAITLALHLCDLVHIAGFGYPDAYNKKQTIHYYEQITLKSMPurity:Min. 95%Mouse PMN antibody (FITC)
Mouse PMN antibody (FITC) was raised in rabbit using mouse PMNs as the immunogen.
CHIT1 antibody
CHIT1 antibody was raised in Mouse using a purified recombinant fragment of CHIT1(aa22-137) expressed in E. coli as the immunogen.
GPR171 antibody
GPR171 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.
Purity:Min. 95%TRPM4 antibody
The TRPM4 antibody is a highly specialized antibody used in the field of life sciences. It is specifically designed to target and neutralize the TRPM4 protein, which plays a crucial role in cellular processes such as calcium signaling and ion transport. This monoclonal antibody has been extensively tested and proven to be highly reactive and effective in inhibiting the activity of TRPM4.
SOX12 antibody
SOX12 antibody was raised in mouse using recombinant Human Sry (Sex Determining Region Y)-Box 12APP antibody
The APP antibody is a powerful tool used in medical research and diagnostics. It specifically targets alpha-fetoprotein (AFP), which is an important biomarker for various diseases, including liver cancer. The APP antibody binds to amyloid plaques, which are abnormal protein deposits found in the brains of individuals with Alzheimer's disease. This antibody can also be used to study growth factors and their binding proteins, providing valuable insights into cellular processes and signaling pathways.
Leucine zipper protein 1 antibody
Affinity purified Rabbit polyclonal Leucine zipper protein 1 antibody
DDOST antibody
DDOST antibody was raised using the N terminal of DDOST corresponding to a region with amino acids SPSVEDFGGNINVETISAFIDGGGSVLVAASSDIGDPLRELGSECGIEFD
Adenovirus antibody
Adenovirus antibody was raised in mouse using the hexon group antigen of numerous ADV serotypes as the immunogen.
ASB6 antibody
ASB6 antibody was raised using the middle region of ASB6 corresponding to a region with amino acids LKMAELGLTRAADVLLRHGANLNFEDPVTYYTALHIAVLRNQPDMVELLVPurity:Min. 95%DDT antibody
The DDT antibody is a monoclonal antibody that belongs to the globulin class of antibodies. It is specifically designed for use in Life Sciences research and has neutralizing properties against the DDT antigen. This antibody can effectively bind to and inhibit the activity of DDT, a toxic chemical compound widely used as an insecticide.
S100P antibody
The S100P antibody is a powerful tool used in the field of Life Sciences. It is an essential component in various laboratory techniques such as hybridization, polymerase chain reaction (PCR), and particle chemiluminescence. This polyclonal antibody specifically targets cytochrome P450 oxidoreductase, which plays a crucial role in drug metabolism and detoxification processes.
PGD antibody
The PGD antibody is a monoclonal antibody used in Life Sciences research. It specifically targets and binds to alpha-fetoprotein, a protein that is associated with various diseases and conditions. The PGD antibody has been extensively tested and proven to be highly specific and sensitive in detecting alpha-fetoprotein in human serum samples. It can be used for various applications such as ELISA, Western blotting, immunohistochemistry, and flow cytometry. The PGD antibody can also be conjugated with different markers or enzymes for enhanced detection and visualization. With its high affinity and cytotoxic properties, the PGD antibody holds great potential for targeted therapy in the future.
PCNA antibody
The PCNA antibody is a highly specific monoclonal antibody that targets the proliferating cell nuclear antigen (PCNA). It is commonly used in research and diagnostic applications to detect and quantify PCNA expression levels. PCNA plays a crucial role in DNA replication and repair, making it an important marker for cell proliferation and DNA synthesis. The PCNA antibody can be used to study various biological processes such as cell cycle progression, tumor growth, and response to DNA damage. With its high specificity and sensitivity, this antibody provides reliable results for researchers in the field of life sciences. Whether you are studying cellular pathways or investigating disease mechanisms, the PCNA antibody is an essential tool for your research.
SOCS3 antibody
The SOCS3 antibody is a biomaterial protein that plays a crucial role in various biological processes. It acts as a negative regulator of cytokine signaling pathways and is involved in the regulation of growth factors. The antibody can bind to sclerostin, an important factor in bone metabolism, and inhibit its activity. Additionally, it has been shown to neutralize the effects of alpha-fetoprotein, a protein associated with liver cancer. The SOCS3 antibody is available in both polyclonal and monoclonal forms, providing researchers with options for their specific experimental needs. Its high affinity and specificity make it an invaluable tool in life sciences research.
CD49d antibody (PE)
CD49d antibody (PE) was raised in mouse using human CD49d as the immunogen.
Purity:Min. 95%HBsAg Mouse Monoclonal Antibody
Please enquire for more information about HBsAg Mouse Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page
Purity:Min. 95%Dengue Virus Type 1 Envelope Antigen, Recombinant
Please enquire for more information about Dengue Virus Type 1 Envelope Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page
Purity:Min. 95%Denosumab
CAS:Monoclonal antibody against RANKL; anti-resorptive agent for osteoperosis treatment
Purity:(Sec-Hplc) Min. 95 Area-%Color and Shape:Clear LiquidRef: 3D-BD165585
Discontinued productCA 125 antibody (biotin)
CA 125 antibody (biotin) was raised in mouse using affinity pure human CA 125 antigen as the immunogen.
