Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,721 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(764 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,585 products)
- Metabolism Antibodies(286 products)
- Microbiology Antibodies(741 products)
- Signal Transduction(2,765 products)
- Tags & Cellular Markers(34 products)
Found 75594 products of "Primary Antibodies"
CPVL antibody
The CPVL antibody is a polyclonal antibody that is widely used in the field of life sciences. It specifically targets epidermal growth factor (EGF) and chemokine receptors, making it an essential tool for researchers studying these signaling pathways. In addition to its polyclonal form, monoclonal antibodies are also available for more specific applications.
Goat anti Rabbit IgG (Texas Red)
Goat anti-rabbit IgG was raised in goat using rabbit IgG F(c) fragment as the immunogen.Purity:Min. 95%Goat anti Human IgG (Fab'2) (Texas Red)
Goat anti-human IgG (Fab'2) was raised in goat using human IgG F(c) fragment as the immunogen.
Purity:Min. 95%USP10 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug belonging to the rifamycin class. It is specifically designed to target tuberculosis infections and contains active compounds that exhibit bactericidal activity. This drug works by inhibiting bacterial growth through its binding to DNA-dependent RNA polymerase, which prevents transcription and replication. The effectiveness of this drug has been demonstrated through extensive research using the patch-clamp technique on human erythrocytes. Additionally, it undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Furthermore, it binds specifically to markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits cell growth in culture.
Myosin Ic antibody
Myosin Ic antibody was raised using the N terminal of MYO1C corresponding to a region with amino acids NPVLEAFGNAKTLRNDNSSRFGKYMDVQFDFKGAPVGGHILSYLLEKSRV
TMPRSS4 antibody
TMPRSS4 antibody was raised using the middle region of TMPRSS4 corresponding to a region with amino acids LSGSLVSLHCLACGKSLKTPRVVGGEEASVDSWPWQVSIQYDKQHVCGGS
RSV antibody
RSV antibody was raised in rabbit using residues 187-198 LCKSICKTIPSNKPKKKP of the RSV G protein B1 strain as the immunogen.Purity:Min. 95%Goat anti Rabbit IgG (FITC)
Goat anti-rabbit IgG (FITC) was raised in goat using rabbit IgG F(c) whole molecule as the immunogen.
Purity:Min. 95%WNT4 antibody
The WNT4 antibody is a highly specialized monoclonal antibody that targets the WNT4 protein, a growth factor involved in various cellular processes. This antibody is designed to specifically bind to WNT4 dimers, inhibiting their activity and preventing downstream signaling pathways.
...C-peptide antibody
The C-peptide antibody is a synthetic, recombinant protein that has been activated for use in various life sciences assays. This antibody is specifically designed to detect and bind to C-peptide, a protein fragment that is cleaved from proinsulin during insulin synthesis. The C-peptide antibody can be used in electrophoresis and other laboratory techniques to study the presence and function of C-peptide in human serum samples. This monoclonal antibody is highly specific and has been extensively characterized for its performance and reliability. It can be used as a valuable tool in research and diagnostic applications related to diabetes, insulin secretion, and related disorders. With its buffered formulation and high sensitivity, the C-peptide antibody ensures accurate and reproducible results in various experimental settings. Trust this antibody for your research needs in the field of endocrinology and beyond.
BAD antibody
The BAD antibody is a polyclonal antibody that specifically targets the BAD protein. BAD (Bcl-2 associated death promoter) is a key regulator of apoptosis, or programmed cell death. This antibody is widely used in life sciences research to study the role of BAD in various cellular processes.
FAM53C antibody
FAM53C antibody was raised using the N terminal of FAM53C corresponding to a region with amino acids SNCGNSFQLVSEGASWRGLPHCSCAEFQDSLNFSYHPSGLSLHLRPPSRG
S100A8 antibody
The S100A8 antibody is a polyclonal antibody that is used for immobilization in various assays. It can be used to detect and measure the levels of S100A8 protein in human serum samples. The antibody is immobilized on an electrode and reacts specifically with S100A8, allowing for accurate quantification. In addition to its use in diagnostics, the S100A8 antibody can also be used as a research tool. It can be used to study the role of S100A8 in various biological processes, such as inflammation and immune response. The antibody has neutralizing properties and can inhibit the activity of reactive oxygen species and interleukins. It is also being investigated as a potential therapeutic agent for conditions such as diuretic resistance and influenza hemagglutinin inhibition. With its versatility and specificity, the S100A8 antibody is a valuable tool for researchers in the life sciences field.
VAMP5 antibody
VAMP5 antibody was raised using a synthetic peptide corresponding to a region with amino acids IRYRICVGLVVVGVLLIILIVLLVVFLPQSSDSSSAPRTQDAGIASGPGN
TRIM9 antibody
The TRIM9 antibody is a highly specialized polyclonal antibody that targets TNF-α, a key cytokine involved in inflammation and immune response. This antibody is also available in a monoclonal form for specific targeting of TNF-α. It has been shown to have neutralizing properties, effectively blocking the activity of TNF-α and preventing its binding to its receptors.
LOXL2 antibody
The LOXL2 antibody is a powerful tool in the field of Life Sciences. It is an antibody that specifically targets and binds to LOXL2, a protein involved in various biological processes. This antibody has been extensively studied and proven to be effective in detecting and quantifying LOXL2 levels in different samples.
KCNK3 antibody
KCNK3 antibody was raised using the C terminal of KCNK3 corresponding to a region with amino acids TCVEQSHSSPGGGGRYSDTPSRRCLCSGAPRSAISSVSTGLHSLSTFRGL
RABGEF1 antibody
RABGEF1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MSLKSERRGIHVDQSDLLCKKGCGYYGNPAWQGFCSKCWREEYHKARQKQ
ALOX15 antibody
ALOX15 antibody was raised using the middle region of ALOX15 corresponding to a region with amino acids QHASVHLGQLDWYSWVPNAPCTMRLPPPTTKDATLETVMATLPNFHQASLPurity:Min. 95%TACC3 antibody
The TACC3 antibody is a highly specialized antibody that plays a crucial role in various biological processes. It is commonly used in the field of Life Sciences for research purposes. This antibody specifically targets TACC3, which stands for transforming acidic coiled-coil-containing protein 3. TACC3 is involved in cell division, growth regulation, and development.
ID4 antibody
The ID4 antibody is a highly specialized product used in the field of Life Sciences. It is commonly employed in chromatographic techniques and immobilization processes. This antibody specifically targets angptl3, a growth factor protein involved in various biological processes such as collagen production and cell growth. The ID4 antibody is known for its neutralizing properties, effectively inhibiting the activity of angptl3 dimers.
PSMB4 antibody
PSMB4 antibody was raised using a synthetic peptide corresponding to a region with amino acids YLKQVLGQMVIDEELLGDGHSYSPRAIHSWLTRAMYSRRSKMNPLWNTMV
METTL1 antibody
METTL1 antibody was raised using the middle region of METTL1 corresponding to a region with amino acids KGQLTKMFFLFPDPHFKRTKHKWRIISPTLLAEYAYVLRVGGLVYTITDV
FLT1 antibody
The FLT1 antibody is a protein that plays a crucial role in Life Sciences. It is composed of acid residues and has been extensively studied for its various functions. This antibody specifically targets the FLT1 receptor, which is involved in regulating processes such as dopamine signaling, nuclear transport, and growth factor signaling. Additionally, it has been found to bind to antigens such as the circumsporozoite protein and ubiquitin. The FLT1 antibody has also shown potential in promoting fas-mediated apoptosis and inhibiting endothelial growth. With its versatility and wide range of applications, this antibody is an essential tool for researchers in the field of Life Sciences.
BDNF antibody
The BDNF antibody is a neuroprotective agent that acts as a family kinase inhibitor. It targets the adiponectin receptor, which is involved in various cellular processes related to adipose tissue. This antibody is commonly used in life sciences research and is available as both polyclonal and monoclonal antibodies.
Alkaline Phosphatase antibody
The Alkaline Phosphatase antibody is a powerful tool used in Life Sciences research. It specifically targets and binds to alkaline phosphatase, an enzyme that plays a crucial role in various biological processes. This antibody is available in both polyclonal and monoclonal forms, providing researchers with options based on their specific needs.
Clostridium difficile Toxin A antibody
The Clostridium difficile Toxin A antibody is a monoclonal antibody that specifically targets the toxin produced by Clostridium difficile bacteria. This antibody is derived from human proteins and contains specific amino acid residues that have been activated to enhance its binding affinity. It works by neutralizing the effects of the toxin, which includes damaging the intestinal lining and causing inflammation.
IL1b antibody
IL1b antibody was raised in rabbit using recombinant human IL-1b as the immunogen.
Purity:Min. 95%Albendazole antibody
The Albendazole antibody is a highly specialized product used in the field of Life Sciences. It belongs to the category of Polyclonal Antibodies and monoclonal antibodies, which are widely used as inhibitors in various research applications. This antibody specifically targets endothelial growth factor, making it a valuable tool for studying angiogenesis and related processes.
Purity:Min. 95%NR2F2 antibody
NR2F2 antibody was raised in rabbit using the N terminal of NR2F2 as the immunogenPurity:Min. 95%Ferritin antibody
The Ferritin antibody is a cytotoxic monoclonal antibody that targets annexin A2, a protein involved in cell growth and signaling. This antibody has been extensively studied in the field of Life Sciences and has shown promising results in various applications. It can be used for the detection and quantification of ferritin, a key iron storage protein, in biological samples. Additionally, this antibody has been used in research to investigate the role of annexin A2 in insulin regulation, as well as its potential as a therapeutic target for diseases such as cancer. The Ferritin antibody is highly specific and can be easily conjugated with streptavidin or other molecules for different experimental setups. Its high affinity towards annexin A2 makes it an excellent tool for studying the interactions between this protein and other molecules such as growth factors or hormones like glucagon. Researchers can utilize this antibody to explore the mechanisms underlying cellular processes and gain valuable insights into various biological pathways.ASL antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug from the rifamycin class. It is highly effective in treating tuberculosis infections and contains active compounds that exhibit bactericidal activity. This drug inhibits bacterial growth by binding to DNA-dependent RNA polymerase, preventing transcription and replication. It has been extensively studied using advanced techniques like patch-clamp to determine its human activity. The metabolism of this drug involves various transformations such as hydrolysis, oxidation, reduction, and conjugation. Additionally, it specifically targets Mycobacterium tuberculosis strains and inhibits their cell growth. With its potent properties, this drug offers a promising solution for combating tuberculosis.
AQP4 antibody
The AQP4 antibody is a glycoprotein that plays a crucial role in the regulation of water balance in the body. It is an essential component of the cell membrane and facilitates the movement of water molecules across cell membranes. The AQP4 antibody is widely used in life sciences research, particularly in studies related to water transport and homeostasis.
TIP47 antibody
TIP47 antibody was raised in guinea pig using synthetic peptide of TIP47 N-terminus as the immunogen.
Purity:Min. 95%SMAD2 antibody
The SMAD2 antibody is a highly specialized biomolecule that plays a crucial role in the field of Life Sciences. This monoclonal antibody is designed to specifically target and neutralize SMAD2, a key protein involved in various cellular processes. It has been extensively studied for its potential applications in research and therapeutic settings.
Purity:Min. 95%PRPF6 antibody
PRPF6 antibody was raised using a synthetic peptide corresponding to a region with amino acids PGKRTVGDQMKKNQAADDDDEDLNDTNYDEFNGYAGSLFSSGPYEKDDEE
Donkey anti Sheep IgG (H + L) (HRP)
This antibody reacts with heavy (gamma) chains on sheep IgG and light chains on all sheep immunoglobulins.Purity:Min. 95%Goat anti Mouse IgG (H + L) (biotin)
This antibody reacts with heavy (gamma) chains on mouse IgG and light chains on all mouse immunoglobulins.
Purity:Min. 95%CHRND antibody
CHRND antibody was raised in rabbit using the N terminal of CHRND as the immunogen
Purity:Min. 95%Methamphetamine antibody
Methamphetamine antibody was raised in mouse using methamphetamine-BSA as the immunogen.PSTK antibody
PSTK antibody was raised using the middle region of PSTK corresponding to a region with amino acids SRPLFLVLDDNFYYQSMRYEVYQLARKYSLGFCQLFLDCPLETCLQRNGQ
Rabbit anti Mouse IgG (H + L)
This antibody reacts with heavy (gamma) chains on rabbit IgG and light chains on all rabbit immunoglobulins.Purity:Min. 95%Gja4 antibody
Gja4 antibody was raised in rabbit using the N terminal of GJA4 as the immunogenPurity:Min. 95%FAM135B antibody
FAM135B antibody was raised using the middle region of FAM135B corresponding to a region with amino acids TLVSTGLWLMQKLKKSGSLLQLTFRDNADLRKCFLYQLSQKTGLQYFKNV
HBsAg Mouse Monoclonal Antibody
Please enquire for more information about HBsAg Mouse Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page
Purity:Min. 95%Denosumab
CAS:Monoclonal antibody against RANKL; anti-resorptive agent for osteoperosis treatment
Purity:(Sec-Hplc) Min. 95 Area-%Color and Shape:Clear LiquidRef: 3D-BD165585
Discontinued productDengue Virus Type 1 Envelope Antigen, Recombinant
Please enquire for more information about Dengue Virus Type 1 Envelope Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page
Purity:Min. 95%CA 125 antibody (biotin)
CA 125 antibody (biotin) was raised in mouse using affinity pure human CA 125 antigen as the immunogen.
