Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,721 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(764 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,585 products)
- Metabolism Antibodies(286 products)
- Microbiology Antibodies(741 products)
- Signal Transduction(2,765 products)
- Tags & Cellular Markers(34 products)
Found 75562 products of "Primary Antibodies"
CEA antibody
The CEA antibody is a monoclonal antibody that targets the carcinoembryonic antigen (CEA), a protein that is overexpressed in certain types of cancer cells. This antibody specifically binds to CEA and can be used for various applications in the field of Life Sciences. It has been widely used in research studies to detect CEA expression in tumor tissues and monitor its levels in patient samples.
alpha 1 Antiplasmin antibody
alpha 1 Antiplasmin antibody was raised in sheep using human alpha 1 Antiplasmin purified from plasma as the immunogen.
Rabbit anti Bovine IgG (H + L) (Texas Red)
Rabbit anti-bovine IgG (H+L) was raised in rabbit using bovine IgG whole molecule as the immunogen.
Purity:Min. 95%XRCC4 antibody
The XRCC4 antibody is a highly specific monoclonal antibody that has an inhibitory effect on the progesterone concentration in human serum. It exhibits strong antioxidant activity and has been shown to neutralize autoantibodies and anti-drug antibodies. The XRCC4 antibody is widely used in various assays, particularly in Life Sciences research, for its ability to detect and quantify specific proteins of interest. This monoclonal antibody is colloidal gold-labeled, making it suitable for use in immunohistochemical staining and other applications requiring high sensitivity and specificity. Additionally, the XRCC4 antibody has been found to be effective in detecting granulosa cell tumors due to its binding affinity with mesothelin, a protein commonly expressed in these types of tumors. Its versatility and reliability make it an essential tool for researchers studying steroid hormones and related biological processes.
CUGBP2 antibody
CUGBP2 antibody was raised using the N terminal of CUGBP2 corresponding to a region with amino acids VYQINVLRDRSQNPPQSKGCCFVTFYTRKAALEAQNALHNIKTLPGMHHP
Ovalbumin antibody
The Ovalbumin antibody is a polyclonal antibody that specifically targets the ovalbumin protein. Ovalbumin is a basic protein found in egg whites and is commonly used in life sciences research as a model antigen. This antibody has been developed to bind to the CD3 receptor, which is expressed on T cells, making it an ideal tool for studying T cell activation and function. The Ovalbumin antibody is reactive and can be used in various applications such as immunohistochemistry, flow cytometry, and Western blotting. It can also be used as a diagnostic reagent for detecting ovalbumin or related proteins in human serum samples. Additionally, this antibody has neutralizing properties and can inhibit the activity of TNF-related apoptosis-inducing ligand (TRAIL), making it a valuable tool for studying cell death pathways. With its high specificity and affinity, the Ovalbumin antibody is an essential tool for researchers working in the field of immunology and molecular biology.
SIGLEC9 antibody
The SIGLEC9 antibody is a polyclonal antibody that specifically targets SIGLEC9, a glycoprotein that plays a crucial role in various biological processes. This antibody is produced using glycine and disulfide bond technology, resulting in high-quality antibodies with excellent specificity and sensitivity. It can be used in various applications in the field of life sciences, such as immunohistochemistry, flow cytometry, and Western blotting.
CHST1 antibody
CHST1 antibody was raised using a synthetic peptide corresponding to a region with amino acids SFVGQLFNQHLDVFYLFEPLYHVQNTLIPRFTQGKSPADRRVMLGASRDL
ADAM10 antibody
The ADAM10 antibody is a highly specialized cytotoxic antibody that targets the tyrosine protease ADAM10. It is widely used in Life Sciences research, particularly in immunohistochemistry studies. This polyclonal antibody has been shown to inhibit the activity of ADAM10, which plays a crucial role in various cellular processes such as interleukin-6 and insulin signaling. The ADAM10 antibody is commonly used as a tool to study the function of this protein and its involvement in disease pathways. Researchers also use monoclonal antibodies against ADAM10 for specific applications, such as insulin or interleukin detection. Additionally, this antibody has potential therapeutic applications due to its ability to modulate ADAM10 activity and downstream effects on cellular processes. Its specificity and high affinity make it an essential tool for studying the biology of ADAM10 and its associated pathways.
Rabbit anti Mouse Kappa Chain (biotin)
Rabbit anti-mouse kappa chain (biotin) was raised in rabbit using murine kappa chain as the immunogen.
Purity:Min. 95%Perforin antibody (biotin)
Perforin antibody (biotin) was raised in mouse using purified granules from human YT lymphoma cell line as the immunogen.Pneumocystis carinii antibody
Pneumocystis carinii antibody was raised in mouse using Pneumocystis carinii isolates as the immunogen.
BMP6 antibody
The BMP6 antibody is a highly specialized collagen-based polyclonal antibody that targets the tyrosine residues in BMP6. This antibody is widely used in life sciences research to study the role of BMP6 in various biological processes. It has been shown to interact with multiple proteins, including plasminogen activator receptor, urokinase plasminogen activator, and alpha-fetoprotein. The BMP6 antibody is available as both a monoclonal and polyclonal antibody, offering researchers flexibility in their experimental design. This antibody has potential therapeutic applications, particularly in the treatment of thrombocytopenia and as a growth factor for tissue repair. Additionally, it has been found to have interactions with hyaluronic acid, further expanding its potential applications in regenerative medicine.
HSPB8 antibody
HSPB8 antibody was raised using the middle region of HSPB8 corresponding to a region with amino acids PEELMVKTKDGYVEVSGKHEEKQQEGGIVSKNFTKKIQLPAEVDPVTVFA
MAP2K2 antibody
MAP2K2 antibody was raised using the N terminal of MAP2K2 corresponding to a region with amino acids LARRKPVLPALTINPTIAEGPSPTSEGASEANLVDLQKKLEELELDEQQK
PSTK antibody
PSTK antibody was raised using the middle region of PSTK corresponding to a region with amino acids SRPLFLVLDDNFYYQSMRYEVYQLARKYSLGFCQLFLDCPLETCLQRNGQ
Protein C antibody (HRP)
Protein C antibody (HRP) was raised in sheep using human Protein C purified from plasma as the immunogen.
ANKRA2 antibody
ANKRA2 antibody was raised in rabbit using the C terminal of ANKRA2 as the immunogen
Purity:Min. 95%vacA antibody
The vacA antibody is a glycoprotein that plays a crucial role in various biological processes. It exhibits phosphatase and tyrosinase activity, which are essential for cellular functions. This cytotoxic antibody binds to specific proteins and antigens, enabling targeted interactions in the body. In human serum, the vacA antibody has been shown to modulate melanogenesis, the process of pigment production in the skin. Its glycopeptide structure allows for effective antigen-antibody reactions, making it an ideal tool for research and diagnostic purposes. Whether you need a monoclonal or polyclonal antibody, our high-quality vacA antibodies are produced using state-of-the-art hybridoma cell technology. Trust our expertise in Life Sciences to provide you with reliable and accurate results for your scientific endeavors.Purity:Min. 95%Parathyroid Hormone antibody
The Parathyroid Hormone antibody is a powerful tool in the field of Life Sciences. This monoclonal antibody specifically targets and binds to Parathyroid Hormone, allowing for precise detection and analysis. It has been extensively used in research studies to investigate the role of Parathyroid Hormone in various biological processes.
STAT6 antibody
The STAT6 antibody is a protein-based antibody that specifically targets and binds to the STAT6 protein. This protein plays a crucial role in cellular signaling pathways and is involved in various biological processes such as immune response, cell growth, and differentiation. The STAT6 antibody can be used in various research applications, including Western blotting, immunohistochemistry, and immunofluorescence.
BTBD12 antibody
BTBD12 antibody was raised in rabbit using the N terminal of BTBD12 as the immunogen
Purity:Min. 95%Endoglin antibody
Endoglin antibody was raised using a synthetic peptide corresponding to a region with amino acids ILEVHVLFLEFPTGPSQLELTLQASKQNGTWPREVLLVLSVNSSVFLHLQ
Cytokeratin 10 antibody
Cytokeratin 10 antibody is a monoclonal antibody that specifically targets and binds to cytokeratin 10, a protein found in epithelial cells. This antibody is commonly used in life sciences research to study the expression and localization of cytokeratin 10 in various tissues and cell types. Cytokeratin 10 plays a crucial role in maintaining the structural integrity of epithelial cells and is involved in cell adhesion, migration, and differentiation processes. By targeting cytokeratin 10, this antibody enables researchers to gain valuable insights into the cellular mechanisms underlying tissue development, wound healing, and diseases such as cancer. With its high specificity and sensitivity, the cytokeratin 10 antibody is an essential tool for scientists investigating the complex functions of epithelial cells in both normal and pathological conditions.
VEGFD antibody
The VEGFD antibody is a powerful tool in the field of Life Sciences. It acts as an inhibitor against TGF-β1 and chemokine, making it an essential component in various research studies. This monoclonal antibody has shown inhibitory properties against protein kinase, insulin, and natriuretic factors. Its unique design allows for precise targeting and binding to specific molecules, ensuring accurate results in immunoassays. With its ability to neutralize interferon activity, the VEGFD antibody opens up new possibilities for studying neurotrophic factors and their role in different biological processes. Researchers can rely on this high-quality antibody to enhance their experiments and gain valuable insights into cellular mechanisms.
HBsAg Mouse Monoclonal Antibody
Please enquire for more information about HBsAg Mouse Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page
Purity:Min. 95%Dengue Virus Type 1 Envelope Antigen, Recombinant
Please enquire for more information about Dengue Virus Type 1 Envelope Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page
Purity:Min. 95%Denosumab
CAS:Monoclonal antibody against RANKL; anti-resorptive agent for osteoperosis treatment
Purity:(Sec-Hplc) Min. 95 Area-%Color and Shape:Clear LiquidRef: 3D-BD165585
Discontinued productCA 125 antibody (biotin)
CA 125 antibody (biotin) was raised in mouse using affinity pure human CA 125 antigen as the immunogen.
