Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,721 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(764 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,585 products)
- Metabolism Antibodies(286 products)
- Microbiology Antibodies(741 products)
- Signal Transduction(2,765 products)
- Tags & Cellular Markers(34 products)
Found 75562 products of "Primary Antibodies"
TNFRSF10B antibody
TNFRSF10B antibody was raised in rabbit using the N terminal of TNFRSF10B as the immunogen
Transferrin antibody
Transferrin antibody was raised in rabbit using rat transferrin as the immunogen.
Purity:Min. 95%FZD9 antibody
FZD9 antibody was raised using a synthetic peptide corresponding to a region with amino acids TRNDPHALCMEAPENATAGPAEPHKGLGMLPVAPRPARPPGDLGPGAGGSPurity:Min. 95%GPR120 antibody
The GPR120 antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It acts as a growth factor and has the ability to neutralize epidermal growth factor (EGF) and TGF-beta. This antibody is widely used in research laboratories and pharmaceutical companies for its inhibitory properties. It specifically targets GPR120, a receptor protein that plays a crucial role in fatty acid metabolism. The GPR120 antibody can be used to study the activation of this receptor and its downstream signaling pathways. Additionally, it has been proven effective in detecting c-myc expression and alpha-fetoprotein levels. With its high specificity and reliability, the GPR120 antibody is an essential tool for researchers working in various fields of study within Life Sciences.
CD107b antibody (FITC)
CD107b antibody (FITC) was raised in rat using glycoproteins purified from BALB/c mouse embryo 3T3 cell line as the immunogen.
Purity:Min. 95%Caspase 6 antibody
The Caspase 6 antibody is a highly specialized immunoassay tool designed for neutralizing the activity of Caspase 6, a drug antibody that plays a crucial role in various cellular processes. This antibody has been extensively studied and proven to be effective in inhibiting the growth factor signaling pathway mediated by Caspase 6. Additionally, it has shown promising results as a potential therapeutic agent for diseases involving abnormal cell proliferation.
RAP1 antibody
The RAP1 antibody is a highly effective monoclonal antibody that specifically targets and neutralizes the activated form of RAP1. This antibody has been extensively tested and proven to be highly efficient in various applications such as lysis, immobilization, and electrode-based assays. It is widely used in Life Sciences research for its ability to inhibit interferon-induced cytotoxicity and promote endothelial growth. The RAP1 antibody is also known for its high affinity towards anti-dnp antibodies, making it an excellent tool for detecting and quantifying these specific antibodies in human serum samples. With its exceptional specificity and reliability, the RAP1 antibody is a valuable asset for any researcher or scientist working in the field of immunology or molecular biology.
VWF antibody (HRP)
VWF antibody (HRP) was raised in sheep using Rat vWF purified from plasma as the immunogen.
MCL1 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug belonging to the rifamycins class. It is specifically designed to target tuberculosis infections and contains active compounds that exhibit bactericidal activity. This drug has been extensively studied using advanced techniques such as transcription-quantitative polymerase chain and patch-clamp technique, which have shown its efficacy in inhibiting bacterial growth. Additionally, it undergoes various metabolic transformations including hydrolysis by esterases, oxidation by cytochrome p450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Its ability to bind to markers expressed in Mycobacterium tuberculosis strains further enhances its effectiveness in inhibiting cell growth.
Legionella pneumophila antibody (HRP)
Legionella pneumophila antibody (HRP) was raised in rabbit using a whole cell preparation of Legionella pneumophila; ATCC #33152 as the immunogen.FAK antibody
The FAK antibody is a highly specialized product in the field of Life Sciences. This monoclonal antibody plays a crucial role in various biological processes, including fatty acid metabolism, insulin signaling, and fibrinogen binding. It is designed to specifically target and bind to focal adhesion kinase (FAK), an important protein involved in cell adhesion and migration.
Purity:Min. 95%IL6 antibody
IL6 antibody is a highly effective therapeutic agent that targets interleukin-6 (IL-6), a key cytokine involved in inflammatory responses. IL-6 plays a crucial role in various physiological processes, including immune response and inflammation. This antibody specifically binds to IL-6, preventing its interaction with its receptors and inhibiting downstream signaling pathways.
CD106 antibody (PE)
CD106 antibody (FITC) was raised in rat using murine CD106/VCAM-1 as the immunogen.
Purity:Min. 95%Molecular weight:0 g/molCD32 antibody (Fab 2)
CD32 antibody (Fab'2) was raised in mouse using human K562 tumor cells and L cells tranfected with human Fc gamma RII as the immunogen.
GBA antibody
The GBA antibody is a polyclonal antibody that specifically targets the primary amino acid sequence of the glucocerebrosidase (GBA) enzyme. This antibody is derived from human serum and has been extensively validated for its specificity and sensitivity. It can be used in various applications, including enzyme-linked immunosorbent assays (ELISAs), Western blotting, and immunohistochemistry.
FZD6 antibody
The FZD6 antibody is a powerful diagnostic agent and inhibitor that belongs to the class of polyclonal antibodies. It plays a crucial role in the field of life sciences, particularly in inhibiting tumor cell growth. This antibody specifically targets lactate, excitotoxicity, extracellular proteins, MIP-1β, fibrinogen, and serine protease. Its unique properties make it an excellent diagnostic biomarker for various medical conditions. With its ability to inhibit the growth of tumor cells, this antibody holds great promise in the development of new and effective medicines.
SMAD antibody
The SMAD antibody is a highly specific monoclonal antibody that targets the SMAD protein, an important regulator of cellular processes. This antibody is widely used in Life Sciences research to study various cellular pathways and signaling cascades. It specifically recognizes the nuclear localization of SMAD and inhibits its function by blocking its interaction with other proteins. The SMAD antibody has been extensively validated for use in immunohistochemistry, western blotting, and other molecular biology techniques. It is a valuable tool for researchers studying cell antigens, glycosylation, exocytosis, and phosphatase activity. Whether you are investigating the role of SMAD in cancer development or studying the effects of interleukin-6 on cellular processes, the SMAD antibody is an essential component of your research toolkit. Choose this high-quality polyclonal antibody to ensure accurate and reliable results in your experiments.
ENOPH1 antibody
ENOPH1 antibody was raised using the N terminal of ENOPH1 corresponding to a region with amino acids IEENVKEYLQTHWEEEECQQDVSLLRKQAEEDAHLDGAVPIPAASGNGVD
RARG antibody
The RARG antibody is a monoclonal antibody that targets the retinoic acid receptor gamma (RARG). It belongs to the family of tyrosine kinase inhibitors and acts as a cytotoxic agent by inhibiting the growth of endothelial cells. This antibody has been extensively studied in Life Sciences research and has shown promising results in neutralizing the effects of growth factors such as trastuzumab and vascular endothelial growth factor (VEGF). Additionally, it has been found to have an inhibitory effect on tyrosinase, an enzyme involved in melanin production. The RARG antibody can be used in various applications, including immunohistochemistry, western blotting, and ELISA assays. With its potential therapeutic applications, this antibody is a valuable tool for researchers and clinicians alike.
Complement C1q antibody
Complement C1q antibody was raised in mouse using human complement C1q as the immunogen.
CD45RC antibody (PE)
CD45RC antibody (PE) was raised in rat using an exon C-depentent epitope of the CD45 glycoprotein as the immunogen.
Purity:Min. 95%Molecular weight:0 g/molbeta Galactosidase antibody
The beta Galactosidase antibody is a powerful tool used in various research applications. This antibody is commonly used in fluorescent immunohistochemistry to detect the presence and localization of beta-Galactosidase in tissues and cells. It can also be used for the detection of beta-Galactosidase activity in nuclear extracts.
SAA4 antibody
SAA4 antibody was raised using the middle region of SAA4 corresponding to a region with amino acids RVYLQGLIDYYLFGNSSTVLEDSKSNEKAEEWGRSGKDPDRFRPDGLPKK
Purity:Min. 95%Denosumab
CAS:Monoclonal antibody against RANKL; anti-resorptive agent for osteoperosis treatment
Purity:(Sec-Hplc) Min. 95 Area-%Color and Shape:Clear LiquidRef: 3D-BD165585
Discontinued productHBsAg Mouse Monoclonal Antibody
Please enquire for more information about HBsAg Mouse Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page
Purity:Min. 95%Dengue Virus Type 1 Envelope Antigen, Recombinant
Please enquire for more information about Dengue Virus Type 1 Envelope Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page
Purity:Min. 95%CA 125 antibody (biotin)
CA 125 antibody (biotin) was raised in mouse using affinity pure human CA 125 antigen as the immunogen.
