Primary Antibodies

IFT74 antibody was raised in rabbit using the C terminal of IFT74 as the immunogen

Rabbit polyclonal IL1RA antibody

Affinity purified Rabbit polyclonal SHC4 antibody

ARHGDIG antibody was raised in Rabbit using Human ARHGDIG as the immunogen

Affinity purified Rabbit polyclonal HMMR antibody

TM9SF1 antibody was raised using the N terminal of TM9SF1 corresponding to a region with amino acids EGVTHYKAGDPVILYVNKVGPYHNPQETYHYYQLPVCCPEKIRHKSLSLG

The AVEN antibody is a highly specialized monoclonal antibody that targets specific molecules in the body. It is particularly effective in binding to β-catenin, collagen, anti-mesothelin, and urokinase plasminogen activator. This antibody is widely used in Life Sciences research for its ability to detect and inhibit the activity of these target molecules.

Affinity purified Rabbit polyclonal MYBPC2 antibody

MFAP3L antibody was raised using the N terminal of MFAP3L corresponding to a region with amino acids MHDSGLLNITKVSFSDRGKYTCVASNIYGTVNNTVTLRVIFTSGDMGVYY

GALNS antibody was raised in Rabbit using Human GALNS as the immunogen

AP1M1 antibody was raised in Rabbit using Human AP1M1 as the immunogen

The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections as it exhibits bactericidal activity. By binding to DNA-dependent RNA polymerase, this drug inhibits bacterial growth by preventing transcription and replication. Its potency has been demonstrated through a patch-clamp technique on human erythrocytes. The active form of this drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits their cell growth in culture.

Goat polyclonal AFP antibody (Fab'2)

Affinity purified Rabbit polyclonal MYO1B antibody

Affinity purified Rabbit polyclonal HICE1 antibody

Rabbit polyclonal RPL5 antibody

CD40LG antibody was raised in Rabbit using Human CD40LG as the immunogen

KCNH6 antibody was raised using a synthetic peptide corresponding to a region with amino acids GKYRTISQIPQFTLNFVEFNLEKHRSSSTTEIEIIAPHKVVERTQNVTEK

Affinity purified Rabbit polyclonal AHI1 antibody

The GILT antibody is a cytotoxic monoclonal antibody that specifically targets amyloid plaque protein dimers. It is widely used in Life Sciences research to study the formation and accumulation of amyloid plaques, which are associated with various neurodegenerative diseases such as Alzheimer's disease. This monoclonal antibody has high specificity and affinity for amyloid plaque protein dimers, making it an excellent tool for detecting and quantifying these abnormal protein aggregates. Additionally, the GILT antibody has been shown to have inhibitory effects on the growth factor signaling pathway, making it a potential therapeutic candidate for diseases characterized by excessive cell proliferation. With its exceptional quality and reliability, this antibody is a valuable asset for researchers investigating amyloid-related disorders.

CDH23 antibody was raised in Rabbit using Human CDH23 as the immunogen

NEDD9 antibody was raised using the middle region of NEDD9 corresponding to a region with amino acids HPPPQLGQSVGSQNDAYDVPRGVQFLEPPAETSEKANPQERDGVYDVPLH

Affinity purified Rabbit polyclonal EIF3K antibody

Affinity purified Rabbit polyclonal AIF1 antibody

ASAH1 antibody was raised in Rabbit using Human ASAH1 as the immunogen

TNFSF13 antibody was raised in rabbit using the middle region of TNFSF13 as the immunogen

The ITGA3 antibody is a protein that belongs to the family of necrosis factor-related apoptosis-inducing proteins. It is a polyclonal antibody that can be used in various life science applications. The ITGA3 antibody has been shown to have an inhibitory effect on colony-stimulating factors and fibrinogen, which are important for cell growth and survival. This antibody can also activate phosphatase and 3-kinase pathways, which play a role in cellular signaling. Additionally, the ITGA3 antibody has been used as a monoclonal antibody to target TNF-related apoptosis-inducing molecules and inhibit their activity. Studies have also shown that this antibody can reduce microvessel density, suggesting its potential as an anti-angiogenic agent.

CD81 antibody was raised in hamster using murine epithelial cell line PAM212 as the immunogen.

Affinity purified Rabbit polyclonal SLC6A4 antibody

The CDK5 antibody is a highly effective neutralizing agent that specifically targets the cyclin-dependent kinase 5 (CDK5). This monoclonal antibody has been extensively studied and has shown remarkable results in inhibiting the activity of CDK5. By binding to CDK5, this antibody prevents its interaction with other proteins and disrupts the signaling pathways involved in cell proliferation and differentiation.

Affinity purified Rabbit polyclonal Vanin 1 antibody

The CD18 antibody is an essential tool in the field of Life Sciences. It belongs to the category of antibodies and is widely used for research purposes. This antibody specifically targets CD18, a protein that plays a crucial role in cell adhesion and immune response.

ERBB2 antibody was raised in Rabbit using Human ERBB2 as the immunogen

The RB1 antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It is designed to specifically target and neutralize the histidine receptor, which plays a crucial role in various biological processes. This antibody has been extensively studied and proven to be effective in blocking the actions of histidine, thereby modulating its effects on cellular signaling pathways.

The MTHFR antibody is a glycosylated glycopeptide that belongs to the class of chemokines. It is used in the field of Life Sciences for various applications, including the detection and quantification of interferon-gamma (IFN-γ) in biological samples. This antibody specifically targets the nuclear protein MTHFR and can be used in experiments such as immunofluorescence and Western blotting. Additionally, it has been shown to have inhibitory effects on factors such as alpha-fetoprotein and β-catenin, making it a valuable tool for studying signal transduction pathways. With its high specificity and affinity, the MTHFR antibody is an essential component for researchers working in the field of molecular biology and cellular signaling.

LPIN2 antibody was raised in rabbit using the C terminal of LPIN2 as the immunogen

The Caspase 8 antibody is a specific monoclonal antibody used for various applications in the field of Life Sciences. It is designed to target and detect caspase 8, an enzyme involved in apoptosis (programmed cell death). This antibody has been extensively tested and validated using human serum samples to ensure its accuracy and reliability.

OTC antibody was raised using the N terminal of OTC corresponding to a region with amino acids AFRNGHNFMVRNFRCGQPLQNKVQLKGRDLLTLKNFTGEEIKYMLWLSAD

The GABRA3 antibody is a biomolecule that specifically targets and inhibits the GABRA3 protein. It is available as a monoclonal antibody, which ensures high specificity and potency. This antibody can be used for various applications in the field of Life Sciences, such as immunoassays, electrophoresis, and colloid-based assays.

AIFM1 antibody was raised in rabbit using the middle region of AIFM1 as the immunogen

The His Tag antibody is a valuable tool in the field of Life Sciences. It is a monoclonal antibody that specifically recognizes and binds to the His tag, which is commonly used as an antigen in protein purification and detection. The His tag is a short sequence of amino acids that can be genetically fused to a target protein, allowing for easy purification using affinity chromatography techniques. This antibody offers high specificity and sensitivity, making it ideal for various applications such as Western blotting, immunoprecipitation, and ELISA assays. It can be used to detect and quantify His-tagged proteins in complex samples, enabling researchers to study protein expression levels and interactions. The His Tag antibody is compatible with a wide range of detection methods including chemiluminescence, fluorescence, and colorimetric assays. Its versatility makes it suitable for use in both research and industrial settings. Whether you are studying protein-protein interactions, investigating cellular signaling pathways, or developing new therapeutic drugs, the His Tag antibody is an

The Notch 2 antibody is a polyclonal antibody that is widely used in life sciences research. It specifically targets the Notch 2 protein, which plays a crucial role in various cellular processes including fibrinogen regulation, epidermal growth factor signaling, chemokine expression, and carbamazepine metabolism. This antibody has neutralizing and cytotoxic effects on cells expressing Notch 2, making it a valuable tool for studying the function of this protein. Additionally, the Notch 2 antibody can be used in diagnostic applications to detect the presence of Notch 2 in tissues or biological samples. Its high specificity and sensitivity make it an excellent choice for researchers and clinicians working with Notch 2-related pathways and diseases.

The CCR5 antibody is a monoclonal antibody that specifically targets the CCR5 receptor, which is a cation-binding protein involved in various cellular processes. This antibody has been extensively studied in the field of Life Sciences and has shown promising results in immunoassays and therapeutic applications.

TRADD antibody was raised in rabbit using the middle region of TRADD as the immunogen

TNFR1 antibody is a highly specific antibody that targets the tumor necrosis factor receptor 1 (TNFR1). It binds to TNFR1 and inhibits its activity, thereby blocking the binding of TNF-α and preventing downstream signaling pathways. This antibody has been extensively studied in various fields of Life Sciences, including cancer research, immunology, and molecular biology.

Affinity purified Rabbit polyclonal HCE antibody

The STAP2 antibody is a highly specialized antibody that targets and neutralizes the activity of STAP2, a protein involved in various cellular processes. This polyclonal antibody is designed to specifically bind to the activated form of STAP2 and inhibit its function. By blocking the interaction between STAP2 and other proteins such as lipoprotein lipase and growth factors, this antibody helps regulate important biological pathways.

Rabbit polyclonal KIAA1967 antibody

COMMD1 antibody was raised in Rabbit using Human COMMD1 as the immunogen

Rabbit polyclonal CKMM antibody (biotin)

ENTPD8 antibody was raised in Rabbit using Human ENTPD8 as the immunogen

SC4MOL antibody was raised using the N terminal of SC4MOL corresponding to a region with amino acids MATNESVSIFSSASLAVEYVDSLLPENPLQEPFKNAWNYMLNNYTKFQIA

Factor XIIIa antibody is a powerful tool used in Life Sciences research for its ability to target and detect Factor XIIIa, an enzyme involved in blood clot formation. This polyclonal antibody specifically binds to Factor XIIIa, allowing researchers to study its role in various biological processes.

The Glyoxalase I antibody is a neuroprotective glycosylation inhibitor that targets glycopeptides such as transferrin, insulin, and fibronectin. It is widely used in Life Sciences research to study the role of glycosylation in various biological processes. This polyclonal antibody specifically binds to acidic collagens and has been shown to be effective in detecting antiphospholipid antibodies and autoantibodies. Additionally, it can be used as an insulin antibody for studying insulin signaling pathways. The Glyoxalase I antibody is a valuable tool for researchers investigating glycosylation-related mechanisms and can serve as an anticoagulant in certain applications. With its high specificity and sensitivity, this antibody is an essential component of any laboratory working with Polyclonal Antibodies.

The CCL2 antibody is a monoclonal antibody that targets the chemokine CCL2, also known as monocyte chemoattractant protein-1 (MCP-1). It is used in Life Sciences research to study the role of CCL2 in various physiological and pathological processes. This antibody specifically binds to CCL2 and can be used for applications such as immunohistochemistry, flow cytometry, and ELISA. The CCL2 antibody has been shown to inhibit the interaction between CCL2 and its receptor, thereby blocking the recruitment of monocytes and other immune cells to inflammatory sites. It is also nephrotoxic in nature, which means it can cause damage to kidney cells. Additionally, polyclonal antibodies derived from human serum or monoclonal antibodies like adalimumab can be used as alternatives to the CCL2 antibody for specific research purposes.

Rabbit polyclonal ERP29 antibody

The PHEX antibody is a highly specialized polyclonal antibody that targets the hormone peptide interleukin-6 (IL-6). It is produced using a hybridoma cell line, which ensures high specificity and potency. This antibody acts as an inhibitory factor, neutralizing the effects of IL-6 and preventing its interaction with receptors.

Monoclonal antibody against RANKL; anti-resorptive agent for osteoperosis treatment

Please enquire for more information about HBsAg Mouse Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page

Please enquire for more information about Dengue Virus Type 1 Envelope Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page

CA 125 antibody (biotin) was raised in mouse using affinity pure human CA 125 antigen as the immunogen.

Cortisol antibody was raised in mouse using cortisol-3 BSA as the immunogen.