Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,721 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(764 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,585 products)
- Metabolism Antibodies(286 products)
- Microbiology Antibodies(741 products)
- Signal Transduction(2,765 products)
- Tags & Cellular Markers(34 products)
Found 75562 products of "Primary Antibodies"
Salmonella antibody
Salmonella antibody was raised in mouse using LPS of Salmonella typhimurium as the immunogen.
TTF1 antibody
TTF1 antibody was raised in mouse using Rat TTF-1 recombinant protein as the immunogen.
TST antibody
TST antibody is a polypeptide expression of autoantibodies that specifically target the protein kinase. This antibody is widely used in Life Sciences research to study the role of protein kinases in various cellular processes. It has been shown to be effective in detecting and quantifying protein kinase activity in microvessel endothelial cells. TST antibody can also be used as a recombinant antigen for biochemical assays and interferon detection. Additionally, it has been utilized to investigate collagen-related diseases and evaluate the effects of inhibitors on protein kinase activity. With its versatility and specificity, TST antibody is an essential tool for researchers studying a wide range of biological processes, including non-alcoholic steatohepatitis and food extract analysis.
Calpain 2 antibody
Calpain 2 antibody was raised in mouse using purified bovine skeletal muscle 80 kDa subunit of m-calpain as the immunogen.
MURF1 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections as it contains active compounds with strong bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, inhibiting bacterial growth and preventing transcription and replication. Its efficacy has been proven through extensive research using the patch-clamp technique on human erythrocytes.
PCYT2 antibody
PCYT2 antibody was raised using the C terminal of PCYT2 corresponding to a region with amino acids KVDLVCHGKTEIIPDRDGSDPYQEPKRRGIFRQIDSGSNLTTDLIVQRII
CD1a antibody
The CD1a antibody is a crucial tool in the field of Life Sciences. It is a monoclonal antibody that specifically targets CD1a, a cell surface protein involved in various biological processes. This antibody can be used for research purposes to study the function and expression of CD1a in different cell types.
HCII antibody
HCII antibody was raised in goat using human HCII purified from plasma as the immunogen.
Purity:Min. 95%HSA antibody
The HSA antibody is a monoclonal antibody that is commonly used in steroid assays and other diagnostic tests involving human serum. It has been shown to have an inhibitory effect on the activity of certain antibodies, making it a valuable tool in research and medical settings. This specific monoclonal antibody has also been found to have anti-mesothelin properties, which makes it useful in the study and treatment of mesothelioma, a type of cancer. Additionally, the HSA antibody has demonstrated antioxidant activity and the ability to inhibit the growth factor in certain cell lines. Its versatility and wide range of applications make it an essential tool in the field of life sciences.
CKS2 antibody
The CKS2 antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It is designed to target and neutralize the toxic effects of colony-stimulating factors, which are proteins that regulate the production and differentiation of white blood cells. The CKS2 antibody specifically targets the phosphatase activity of colony-stimulating factors, inhibiting their ability to stimulate cell growth and division.
SOCS3 antibody
The SOCS3 antibody is a highly effective histone deacetylase inhibitor that has shown promising results in various medical applications. This monoclonal antibody acts by targeting and neutralizing the activity of p38 MAPK, a protein involved in the regulation of immune responses. By inhibiting p38 MAPK, the SOCS3 antibody helps to modulate inflammatory processes and reduce tissue damage.Goat anti Human kappa chain (HRP)
This antibody reacts with kappa light chains on human immunoglobulins.Purity:Min. 95%Lgi2 antibody
Lgi2 antibody was raised in rabbit using the middle region of Lgi2 as the immunogen
Purity:Min. 95%PTBP2 antibody
PTBP2 antibody was raised using the N terminal of PTBP2 corresponding to a region with amino acids MDGIVTEVAVGVKRGSDELLSGSVLSSPNSNMSSMVVTANGNDSKKFKGE
PSMB4 antibody
PSMB4 antibody was raised using a synthetic peptide corresponding to a region with amino acids YLKQVLGQMVIDEELLGDGHSYSPRAIHSWLTRAMYSRRSKMNPLWNTMV
ZFP36 antibody
The ZFP36 antibody is a polypeptide that belongs to the family of Polyclonal Antibodies. It is also available as a monoclonal antibody. This antibody is widely used in the field of Life Sciences for various research applications. The polyclonal antibodies are produced by immunizing animals with specific antigens, resulting in the production of antibodies that recognize multiple epitopes on the target protein. On the other hand, monoclonal antibodies are produced from a single clone of cells and recognize a specific epitope on the target protein. Both types of antibodies are valuable tools in scientific research for studying protein expression, localization, and function.
CD5 antibody
The CD5 antibody is a monoclonal antibody that targets CD20, a glycoprotein expressed on the surface of B cells. It is widely used in the field of life sciences for research purposes. The CD5 antibody acts as an inhibitor by binding to CD20 and preventing its interaction with other molecules, thus inhibiting B cell activation and proliferation. This antibody can be immobilized on various surfaces for use in assays or experiments. It has been shown to have chemokine-like properties and can induce apoptosis in certain cancer cell lines, such as MCF-7. Additionally, the CD5 antibody can be used in combination with recombinant proteins or other antibodies to create antibody-drug conjugates or for targeted therapy. Its versatility and specificity make it a valuable tool in the field of protein research and drug development.
ZHX2 antibody
The ZHX2 antibody is a powerful tool used in the field of Life Sciences. It specifically targets and binds to collagen, a protein found abundantly in the body. This antibody has shown antinociceptive properties, meaning it can help alleviate pain sensations. Additionally, it has been observed to be effective in inhibiting the activation of certain phosphorylation sites, which play a crucial role in cellular signaling pathways.
Purity:Min. 95%FAN antibody
The FAN antibody is a highly versatile and effective tool used in various assays and hybridization techniques. It is an isothiocyanate-conjugated monoclonal antibody that specifically targets alpha-fetoprotein (AFP). This antibody has been widely used in research and diagnostic applications for the detection and quantification of AFP in biological samples.
MMACHC antibody
The MMACHC antibody is a monoclonal antibody that targets oncostatin and e-cadherin expression. It is commonly used in Life Sciences research to study the role of these proteins in various cellular processes. This antibody specifically binds to e-cadherin, a protein involved in cell adhesion and tissue integrity. By targeting e-cadherin, the MMACHC antibody can provide valuable insights into cell signaling pathways and cellular interactions. Additionally, this antibody has been shown to be effective in detecting osteopontin, a protein associated with bone remodeling and cancer metastasis. The MMACHC antibody can be used for various applications such as immunohistochemistry, Western blotting, and flow cytometry. With its high specificity and sensitivity, this antibody is an essential tool for researchers studying protein-protein interactions and cellular mechanisms.
FLT1 antibody
The FLT1 antibody is a protein that plays a crucial role in Life Sciences. It is composed of acid residues and has been extensively studied for its various functions. This antibody specifically targets the FLT1 receptor, which is involved in regulating processes such as dopamine signaling, nuclear transport, and growth factor signaling. Additionally, it has been found to bind to antigens such as the circumsporozoite protein and ubiquitin. The FLT1 antibody has also shown potential in promoting fas-mediated apoptosis and inhibiting endothelial growth. With its versatility and wide range of applications, this antibody is an essential tool for researchers in the field of Life Sciences.
CD62E antibody
The CD62E antibody is a monoclonal antibody that has antiviral properties and is commonly used in research and medical applications. It specifically targets the CD62E protein, also known as E-selectin, which plays a crucial role in immune response and inflammation. This antibody works by binding to the CD62E protein, preventing its interaction with other molecules involved in immune cell adhesion and migration.LOC642097 antibody
LOC642097 antibody was raised using the N terminal Of Loc642097 corresponding to a region with amino acids MSDAHLGEAVDDIVSALKLGPGTVVPELRSLKPEAQALITQGLYSHCRAL
NUP155 antibody
NUP155 antibody was raised using the N terminal of NUP155 corresponding to a region with amino acids MPSSLLGAAMPASTSAAALQEALENAGRLIDRQLQEDRMYPDLSELLMVS
Denosumab
CAS:Monoclonal antibody against RANKL; anti-resorptive agent for osteoperosis treatment
Purity:(Sec-Hplc) Min. 95 Area-%Color and Shape:Clear LiquidRef: 3D-BD165585
Discontinued productDengue Virus Type 1 Envelope Antigen, Recombinant
Please enquire for more information about Dengue Virus Type 1 Envelope Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page
Purity:Min. 95%HBsAg Mouse Monoclonal Antibody
Please enquire for more information about HBsAg Mouse Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page
Purity:Min. 95%CA 125 antibody (biotin)
CA 125 antibody (biotin) was raised in mouse using affinity pure human CA 125 antigen as the immunogen.
