Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,620 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(751 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,551 products)
- Metabolism Antibodies(279 products)
- Microbiology Antibodies(740 products)
- Signal Transduction(2,717 products)
- Tags & Cellular Markers(33 products)
Found 75448 products of "Primary Antibodies"
Transglutaminase 2 antibody
Transglutaminase 2 antibody is a highly specialized monoclonal antibody that targets the transglutaminase 2 protein. This protein plays a crucial role in various cellular processes, including apoptosis, cell adhesion, and signal transduction. The antibody specifically recognizes and binds to transglutaminase 2, inhibiting its enzymatic activity.
VDAC1 antibody
VDAC1 antibody was raised using the C terminal of VDAC1 corresponding to a region with amino acids SAKVNNSSLIGLGYTQTLKPGIKLTLSALLDGKNVNAGGHKLGLGLEFQA
IL17F antibody
IL17F antibody was raised in rabbit using highly pure recombinant human IL-17F as the immunogen.Purity:Min. 95%Desmocollin 1 antibody
Desmocollin 1 antibody was raised in mouse using synthetic peptide corresponding to sequence present within the intracellular part of human desmocollin 1 as the immunogen.GANP antibody
GANP antibody is a monoclonal antibody that targets the GANP protein. This protein plays a crucial role in various cellular processes, including histidine metabolism, epidermal growth factor signaling, and β-catenin regulation. By specifically binding to GANP, this antibody inhibits its function and disrupts the normal cellular processes associated with it.
RTP4 antibody
RTP4 antibody was raised using a synthetic peptide corresponding to a region with amino acids SSDSTMRILSNLVQHILKKYYGNGTRKSPEMPVILEVSLEGSHDTANCEA
RAB11FIP5 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections, thanks to its bactericidal activity. This active compound works by binding to DNA-dependent RNA polymerase, which prevents transcription and replication, inhibiting bacterial growth. The efficacy of this drug has been demonstrated through the use of a patch-clamp technique on human erythrocytes.
TFG antibody
TFG antibody is a monoclonal antibody that specifically targets amyloid plaque, a hallmark of various neurodegenerative diseases. This antibody recognizes and binds to the TFG glycoprotein, which is present in amyloid plaques. By binding to these plaques, the TFG antibody helps to clear them from the brain and reduce their accumulation.
ATP6V1G2 antibody
ATP6V1G2 antibody was raised in rabbit using the middle region of ATP6V1G2 as the immunogen
Purity:Min. 95%HRP antibody
The HRP antibody is a highly sought-after product in the field of Life Sciences. It is available as both a monoclonal antibody and polyclonal antibodies. This antibody has been extensively studied and proven to be effective in various applications.Purity:Min. 95%PFKFB3 antibody
The PFKFB3 antibody is a highly specialized tool used in the field of Life Sciences. It belongs to the category of Polyclonal Antibodies and is designed to target and bind to specific proteins associated with PFKFB3. This antibody can be used in various applications such as solid phase assays, histidine quantitation, and messenger RNA analysis.
SCYL3 antibody
SCYL3 antibody was raised using a synthetic peptide corresponding to a region with amino acids MGSENSALKSYTLREPPFTLPSGLAVYPAVLQDGKFASVFVYKRENEDKV
Goat anti Human IgG + IgA + IgM (H + L) (rhodamine)
Goat anti-human IgG/IgA/IgM (H+L) (Rhodamine) was raised in goat using human IgG, IgA and IgM whole molecules as the immunogen.
Purity:Min. 95%ALPPL2 antibody
The ALPPL2 antibody is a polyclonal antibody used in the field of Life Sciences. It specifically targets ALPPL2, which is an enzyme involved in various cellular processes. This antibody has been extensively studied and proven to be effective in detecting ALPPL2 expression in different tissues and cell types.
MMP1 antibody
MMP1 antibody was raised in mouse using a synthetic peptide (VQGQNVLHGYPKDIYSSFG) corresponding to amino acid residues 332-350 0f human MMP-1 as the immunogen.
Goat anti Rabbit IgG (Fab'2) (HRP)
Goat anti-rabbit IgG (Fab'2) (HRP) was raised in goat using rabbit IgG F(c) fragment as the immunogen.Purity:Min. 95%FAM54A antibody
FAM54A antibody was raised using the middle region of FAM54A corresponding to a region with amino acids NKTNYSHHSKSQRNKDIPNMLDVLKDMNKVKLRAIERSPGGRPIHKRKRQ
C-peptide antibody
The C-peptide antibody is a monoclonal antibody that is used for various applications in medical research and diagnostics. It is designed to specifically target and bind to the C-peptide, a peptide released during the processing of proinsulin into insulin. This antibody has been extensively characterized and validated for its high specificity and sensitivity.
HBsAg Mouse Monoclonal Antibody
Please enquire for more information about HBsAg Mouse Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page
Purity:Min. 95%Dengue Virus Type 1 Envelope Antigen, Recombinant
Please enquire for more information about Dengue Virus Type 1 Envelope Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page
Purity:Min. 95%Denosumab
CAS:Monoclonal antibody against RANKL; anti-resorptive agent for osteoperosis treatment
Purity:(Sec-Hplc) Min. 95 Area-%Color and Shape:Clear LiquidRef: 3D-BD165585
Discontinued productCA 125 antibody (biotin)
CA 125 antibody (biotin) was raised in mouse using affinity pure human CA 125 antigen as the immunogen.
