Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,620 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(751 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,551 products)
- Metabolism Antibodies(279 products)
- Microbiology Antibodies(740 products)
- Signal Transduction(2,717 products)
- Tags & Cellular Markers(33 products)
Found 75447 products of "Primary Antibodies"
Mouse Macrophage antibody (FITC)
Mouse macrophage antibody (FITC) was raised in rabbit using mouse macrophages as the immunogen.PSMA3 antibody
PSMA3 antibody was raised using a synthetic peptide corresponding to a region with amino acids VKDKAFELELSWVGELTNGRHEIVPKDIREEAEKYAKESLKEEDESDDDN
GABAB Receptor antibody
The GABAB Receptor antibody is a protein-based product that has chromatographic characteristics. It is a neutralizing antibody that targets the angptl3 protein, which is involved in various biological processes such as collagen synthesis and growth factor regulation. This monoclonal antibody specifically binds to the GABAB receptor, an important component of the central nervous system. By targeting this receptor, the antibody can modulate neurotransmission and potentially have therapeutic effects in neurological disorders. The GABAB Receptor antibody is activated upon binding to its target and can induce cytotoxic effects on cells expressing the receptor. Additionally, it may interact with other binding proteins such as epidermal growth factor and hepatocyte growth factor, further expanding its potential applications in research and medicine.
GLP1 antibody
The GLP1 antibody is a highly effective inhibitor that targets human serum and inhibitory factors, such as leukemia inhibitory factor. It is an antibody specifically designed to neutralize the activity of GLP1, which is a hormone peptide involved in various physiological processes. This monoclonal antibody has been extensively studied and proven to be cytotoxic against specific cell types. Its unique mechanism of action involves binding to GLP1 receptors and interfering with downstream signaling pathways. The GLP1 antibody has shown promising results in preclinical studies and holds great potential for therapeutic applications in the field of Life Sciences.DPPA5 antibody
DPPA5 antibody was raised using the N terminal of DPPA5 corresponding to a region with amino acids MGTLPARRHIPPWVKVPEDLKDPEVFQVQTRLLKAIFGPDGSRIPYIEQV
Chromogranin A antibody
Chromogranin A antibody was raised in mouse using human pheochromocytoma as the immunogen.
Cytokeratin 8 antibody
Cytokeratin 8 antibody is a neutralizing monoclonal antibody that targets collagen. It is used in Life Sciences research to study the role of cytokeratin 8 in various cellular processes. This antibody can specifically bind to cytokeratin 8, which is an intermediate filament protein found in epithelial cells. By targeting cytokeratin 8, this antibody can help researchers investigate its interactions with other proteins such as e-cadherin and β-catenin, as well as its involvement in signaling pathways mediated by growth factors like epidermal growth factor and TGF-beta. Additionally, the use of this antibody has been shown to correlate with changes in microvessel density and activation of certain cellular processes. With its high specificity and affinity for cytokeratin 8, this antibody is a valuable tool for studying the biology of epithelial cells and their associated diseases.
RPB8 antibody
The RPB8 antibody is an acidic monoclonal antibody that belongs to the colony-stimulating factor family. It is widely used in life sciences research for its ability to specifically bind to RPB8, a subunit of RNA polymerase II. This antibody has been shown to have toxic effects on cancer cells and can be used in various applications such as Western blotting, immunohistochemistry, and flow cytometry. The RPB8 antibody can also be used in combination with other antibodies, such as alpha-fetoprotein or vasoactive intestinal peptide, to study their interactions and signaling pathways. Additionally, this antibody has been shown to modulate the activity of phosphatases and interferons, making it a valuable tool for studying cellular processes and immune responses.
AND1 antibody
AND1 antibody was raised in mouse using Nuclear fraction prepared from Xenopus laevis oocytes as the immunogen.SLC6A1 antibody
The SLC6A1 antibody is a highly specialized monoclonal antibody that is used in Life Sciences research. It has been specifically designed to target and bind to the SLC6A1 protein, also known as the glycine transporter 1. This protein plays a crucial role in the transport of glycine, an important neurotransmitter involved in synaptic signaling.
L1CAM antibody
The L1CAM antibody is a powerful tool in the field of Life Sciences. It is a monoclonal antibody that specifically targets L1CAM, a glycoprotein involved in cell adhesion and migration. This antibody has been extensively studied and proven to be effective in various applications.
HES1 antibody
The HES1 antibody is a potent medicament that belongs to the class of antibodies. It specifically targets and neutralizes the activity of interferon-gamma (IFN-gamma), a growth factor involved in various cellular processes. This monoclonal antibody has been shown to inhibit the expression and function of urokinase plasminogen activator (uPA), which is responsible for thrombocytopenia and other clotting disorders. Additionally, the HES1 antibody has cytotoxic effects on cells expressing alpha-fetoprotein, a marker commonly found in certain types of cancer. Through its binding to the plasminogen activator receptor, this antibody disrupts signal transduction pathways involving tyrosine kinases, leading to impaired cell proliferation and survival. The HES1 antibody is widely used in Life Sciences research for its ability to modulate immune responses and investigate IFN-gamma-related diseases.
PCYT2 antibody
PCYT2 antibody was raised using the C terminal of PCYT2 corresponding to a region with amino acids KVDLVCHGKTEIIPDRDGSDPYQEPKRRGIFRQIDSGSNLTTDLIVQRII
HAX1 antibody
The HAX1 antibody is an antiviral medication that acts as an inhibitor of methyl transferase. It plays a crucial role in the regulation of interleukin and serves as a serum marker in Life Sciences. This biomarker composition has been shown to be effective in detecting autoantibodies and is widely used in high-flux monoclonal antibody therapy. The HAX1 antibody is a potent medicament that targets specific cation channels and carnitine, making it an essential component for various medical applications. With its remarkable efficacy and versatility, the HAX1 antibody offers promising solutions for combating viral infections and promoting overall health.
HSV2 antibody (HRP)
HSV2 antibody (HRP) was raised in sheep using HSV type 2, strain G as the immunogen.
Human Nuclei antibody
The Human Nuclei antibody is a monoclonal antibody that specifically targets the nuclei of human cells. It recognizes sugar moieties on nuclear proteins and can be used for various applications in life sciences research. This antibody has been shown to be highly specific and sensitive, allowing for accurate detection of human nuclei in tissue samples.
HLADR antibody
The HLADR antibody is a highly specialized monoclonal antibody that is used in the field of Life Sciences. It is designed to specifically bind to the HLADR receptor, which plays a crucial role in immune system function. This antibody has been extensively tested and shown to have high affinity and specificity for its target.
CD49d antibody (PE)
CD49d antibody (PE) was raised in mouse using human CD49d as the immunogen.
Purity:Min. 95%proBNP antibody
The proBNP antibody is a monoclonal antibody that specifically targets and inhibits the activity of proBNP, an important biomarker for heart failure. This antibody has been extensively studied and shown to effectively neutralize proBNP in human serum samples, making it a valuable tool in cardiovascular research and diagnostics. By blocking the binding of proBNP to its receptor, this antibody can help regulate the levels of this peptide hormone, which plays a crucial role in fluid balance and cardiac function. Additionally, the proBNP antibody has potential applications in therapeutic interventions for heart failure and other related conditions. Its specificity and high affinity make it an ideal candidate for further investigation in the field of cardiology and life sciences.
ANKRA2 antibody
ANKRA2 antibody was raised in rabbit using the C terminal of ANKRA2 as the immunogen
Purity:Min. 95%Tyrosine Hydroxylase antibody
The Tyrosine Hydroxylase antibody is a polyclonal antibody that is commonly used in life sciences research. It is designed to specifically bind to tyrosine hydroxylase, an enzyme involved in the synthesis of dopamine, a neurotransmitter. This antibody can be used in various applications such as immunohistochemistry, Western blotting, and ELISA assays.
Denosumab
CAS:Monoclonal antibody against RANKL; anti-resorptive agent for osteoperosis treatment
Purity:(Sec-Hplc) Min. 95 Area-%Color and Shape:Clear LiquidRef: 3D-BD165585
Discontinued productDengue Virus Type 1 Envelope Antigen, Recombinant
Please enquire for more information about Dengue Virus Type 1 Envelope Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page
Purity:Min. 95%HBsAg Mouse Monoclonal Antibody
Please enquire for more information about HBsAg Mouse Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page
Purity:Min. 95%CA 125 antibody (biotin)
CA 125 antibody (biotin) was raised in mouse using affinity pure human CA 125 antigen as the immunogen.
