Primary Antibodies

GALE antibody was raised in Rabbit using Human GALE as the immunogen

Affinity purified Rabbit polyclonal CaMK1D antibody

Affinity purified Rabbit polyclonal L xylulose reductase antibody

The CRYAB antibody is a highly effective tool for research in the field of Life Sciences. It is specifically designed to target and bind to CRYAB, a protein that plays a crucial role in various cellular processes. This antibody can be used to study the activation of CRYAB in response to different stimuli, as well as its interactions with other proteins and molecules.

POLK antibody was raised using a synthetic peptide corresponding to a region with amino acids ATECTLEKTDKDKFVKPLEMSHKKSFFDKKRSERKWSHQDTFKCEAVNKQ

Purified Polyclonal PDE4B/C/D antibody

Affinity purified Rabbit polyclonal ATP6V0A2 antibody

Rabbit polyclonal KIAA1967 antibody

Mouse monoclonal CALCOCO2 antibody

Rabbit polyclonal UBTD2 antibody

The STAP2 antibody is a highly specialized antibody that targets and neutralizes the activity of STAP2, a protein involved in various cellular processes. This polyclonal antibody is designed to specifically bind to the activated form of STAP2 and inhibit its function. By blocking the interaction between STAP2 and other proteins such as lipoprotein lipase and growth factors, this antibody helps regulate important biological pathways.

The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug belonging to the rifamycins class. It is specifically designed to combat tuberculosis infections by targeting active compounds and exhibiting bactericidal activity. Through its unique mechanism of action, this drug inhibits bacterial growth by binding to DNA-dependent RNA polymerase, preventing transcription and replication. Extensive research has demonstrated its high efficacy using advanced techniques like the patch-clamp technique on human erythrocytes. Metabolized through various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid, this drug offers a comprehensive approach to tackling Mycobacterium tuberculosis strains. Experience the exceptional potency of 6-Fluoro-3-indoxyl-beta-D-galactopyranoside in combating tuberculosis

Affinity purified Rabbit polyclonal HCE antibody

Troponin I antibody (cardiac) was raised in goat using human cardiac troponin I as the immunogen.

Rabbit polyclonal C1D antibody (FITC)

CD8B antibody was raised using the N terminal of CD8B corresponding to a region with amino acids RIYWLRQRQAPSSDSHHEFLALWDSAKGTIHGEEVEQEKIAVFRDASRFI

TNFR1 antibody is a highly specific antibody that targets the tumor necrosis factor receptor 1 (TNFR1). It binds to TNFR1 and inhibits its activity, thereby blocking the binding of TNF-α and preventing downstream signaling pathways. This antibody has been extensively studied in various fields of Life Sciences, including cancer research, immunology, and molecular biology.

Rabbit polyclonal Clofibrate antibody

The TPM2 antibody is a highly specialized protein kinase that plays a crucial role in various biological processes. It belongs to the family of polyclonal antibodies and is widely used in life sciences research. This antibody specifically targets β-catenin, a key protein involved in cell adhesion and signaling pathways. By binding to β-catenin, the TPM2 antibody can modulate its activity and regulate downstream cellular processes.

TRADD antibody was raised in rabbit using the middle region of TRADD as the immunogen

The Cystatin B antibody is a highly specialized monoclonal antibody used in Life Sciences research. It is designed to specifically target and bind to Cystatin B, a fatty acid-binding protein involved in various cellular processes. This antibody is particularly useful for studying the role of Cystatin B in interferon-activated pathways, endocytic uptake mechanisms, and low-density lipoprotein metabolism.

The CCR5 antibody is a monoclonal antibody that specifically targets the CCR5 receptor, which is a cation-binding protein involved in various cellular processes. This antibody has been extensively studied in the field of Life Sciences and has shown promising results in immunoassays and therapeutic applications.

The Notch 2 antibody is a polyclonal antibody that is widely used in life sciences research. It specifically targets the Notch 2 protein, which plays a crucial role in various cellular processes including fibrinogen regulation, epidermal growth factor signaling, chemokine expression, and carbamazepine metabolism. This antibody has neutralizing and cytotoxic effects on cells expressing Notch 2, making it a valuable tool for studying the function of this protein. Additionally, the Notch 2 antibody can be used in diagnostic applications to detect the presence of Notch 2 in tissues or biological samples. Its high specificity and sensitivity make it an excellent choice for researchers and clinicians working with Notch 2-related pathways and diseases.

Affinity purified Rabbit polyclonal gamma Actin antibody

Affinity purified Rabbit polyclonal NEK4 antibody

The His Tag antibody is a valuable tool in the field of Life Sciences. It is a monoclonal antibody that specifically recognizes and binds to the His tag, which is commonly used as an antigen in protein purification and detection. The His tag is a short sequence of amino acids that can be genetically fused to a target protein, allowing for easy purification using affinity chromatography techniques. This antibody offers high specificity and sensitivity, making it ideal for various applications such as Western blotting, immunoprecipitation, and ELISA assays. It can be used to detect and quantify His-tagged proteins in complex samples, enabling researchers to study protein expression levels and interactions. The His Tag antibody is compatible with a wide range of detection methods including chemiluminescence, fluorescence, and colorimetric assays. Its versatility makes it suitable for use in both research and industrial settings. Whether you are studying protein-protein interactions, investigating cellular signaling pathways, or developing new therapeutic drugs, the His Tag antibody is an

Myosin Ic antibody was raised using the N terminal of MYO1C corresponding to a region with amino acids NPVLEAFGNAKTLRNDNSSRFGKYMDVQFDFKGAPVGGHILSYLLEKSRV

AIFM1 antibody was raised in rabbit using the middle region of AIFM1 as the immunogen

The GABRA3 antibody is a biomolecule that specifically targets and inhibits the GABRA3 protein. It is available as a monoclonal antibody, which ensures high specificity and potency. This antibody can be used for various applications in the field of Life Sciences, such as immunoassays, electrophoresis, and colloid-based assays.

OTC antibody was raised using the N terminal of OTC corresponding to a region with amino acids AFRNGHNFMVRNFRCGQPLQNKVQLKGRDLLTLKNFTGEEIKYMLWLSAD

This mouse monoclonal antibody is complementary to the Zika envelope protein, with batches of the IgG1k immunoglobulin subclass available. It has been purified by DEAE column chromatography and is presented as a liquid in 0.015M potassium phosphate, 0.85% NaCl, pH 7.2.
Transmitted by infected mosquitoes, the Zika virus, although it causes asymptotic and mild symptoms in the majority of cases, it can lead to neurological complications and Guillain-Barré syndrome in adults. Furthermore during pregnancy, infants may be born with microcephaly and congenital malformations, known as Zika syndrome. The envelope protein located on the Zika viral membrane and to which this mouse Mab is complementary, is involved in virus and host cell surface receptor binding. It has 3 domains (I, II and III) and a stem-transmembrane domain. Domain I functions to link Domain III (which is the host cell receptor binding domain) to Domain II in order to dimerise and form a fusion loop.
The accessible location of the Envelope protein on the viral membrane means it can be an important target for neutralising antibodies and vaccine development. This product can further be used in the rapid lateral flow detection of Zika envelope protein and other antibody and antigen interaction dependent assays such as ELISA and western blot.

Goat anti-human IgG (Alk Phos) was raised in goat using human IgG F(c) fragment as the immunogen.

The Caspase 8 antibody is a specific monoclonal antibody used for various applications in the field of Life Sciences. It is designed to target and detect caspase 8, an enzyme involved in apoptosis (programmed cell death). This antibody has been extensively tested and validated using human serum samples to ensure its accuracy and reliability.

LPIN2 antibody was raised in rabbit using the C terminal of LPIN2 as the immunogen

Affinity purified Rabbit polyclonal PSMB8 antibody

Please enquire for more information about HBsAg Mouse Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page

Monoclonal antibody against RANKL; anti-resorptive agent for osteoperosis treatment

Please enquire for more information about Dengue Virus Type 1 Envelope Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page

CA 125 antibody (biotin) was raised in mouse using affinity pure human CA 125 antigen as the immunogen.

Cortisol antibody was raised in mouse using cortisol-3 BSA as the immunogen.