Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,620 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(751 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,551 products)
- Metabolism Antibodies(279 products)
- Microbiology Antibodies(739 products)
- Signal Transduction(2,717 products)
- Tags & Cellular Markers(33 products)
Found 75447 products of "Primary Antibodies"
MLSTD2 antibody
MLSTD2 antibody was raised using the N terminal Of Mlstd2 corresponding to a region with amino acids LRSCPKVNSVYVLVRQKAGQTPQERVEEVLSGKLFDRLRDENPDFREKII
CALML3 antibody
CALML3 antibody was raised in rabbit using the middle region of CALML3 as the immunogen
TNFSF15 antibody
TNFSF15 antibody is a polyclonal antibody that targets TNFSF15, a member of the tumor necrosis factor (TNF) ligand superfamily. It plays a crucial role in immune regulation and inflammation. This antibody can bind to TNFSF15 and inhibit its activity, preventing it from binding to its receptor and initiating downstream signaling pathways. TNFSF15 antibody has been shown to have lysis activity against target cells expressing TNFSF15, making it a potential therapeutic option for conditions associated with TNFSF15 overexpression. Additionally, this antibody can be used in research applications such as western blotting, immunohistochemistry, and flow cytometry to detect and quantify TNFSF15 expression levels. With its high specificity and sensitivity, TNFSF15 antibody is a valuable tool for studying the function of TNFSF15 in various biological processes.
CD70 antibody
The CD70 antibody is a potent antitumor agent that has been shown to inhibit the growth of tumors by reducing microvessel density and suppressing endothelial cell growth. This monoclonal antibody specifically targets the CD70 receptor, which is overexpressed in various cancer cells. By binding to this receptor, the CD70 antibody exerts cytotoxic effects on tumor cells, leading to their destruction.
ATXN7L1 antibody
ATXN7L1 antibody was raised using the middle region of ATXN7L1 corresponding to a region with amino acids KVPSPEAFLGKPWSSWIDAAKLHCSDNVDLEEAGKEGGKSREVMRLNKED
Rabbit anti Mouse IgG (H + L)
This antibody reacts with heavy (gamma) chains on rabbit IgG and light chains on all rabbit immunoglobulins.Purity:Min. 95%Tau antibody
The Tau antibody is a highly specialized antibody used in the field of Life Sciences. It is a monoclonal antibody that specifically targets and binds to Tau proteins. Tau proteins play a crucial role in maintaining the structure and function of nerve cells in the brain. However, in certain neurodegenerative diseases such as Alzheimer's disease, these proteins become abnormally phosphorylated and form tangles, leading to cognitive decline.
QSOX1 antibody
The QSOX1 antibody is a monoclonal antibody that plays a crucial role in neutralizing the growth factor and steroid histidine. It is widely used in Life Sciences for its ability to target and bind to specific antigens, facilitating various research applications. This high-quality antibody is produced through hybridization techniques, ensuring its specificity and efficacy. The QSOX1 antibody has shown promising results in studies related to enzastaurin, dopamine, and natriuretic factors. It can also be utilized for the detection of autoantibodies and antigen-antibody reactions. With its exceptional binding capabilities, this monoclonal antibody is an invaluable tool for researchers in the field of Life Sciences.
IL6 antibody
IL6 antibody was raised in goat using highly pure recombinant human IL-6 as the immunogen.
CYTL1 antibody
The CYTL1 antibody is a highly specialized antibody that plays a crucial role in various biological processes. It belongs to the class of polyclonal antibodies and is specifically designed to target and neutralize the effects of CYTL1.
Hsp90 antibody
The Hsp90 antibody is a polyclonal antibody that is widely used in life sciences research. It is commonly used in vitro assays to detect and quantify the presence of Hsp90, a protein that plays a crucial role in cellular processes. This antibody specifically recognizes the Hsp90 protein by binding to specific amino acid residues on its surface.
NRF1 antibody
The NRF1 antibody is a powerful tool used in life sciences research. It specifically targets the nuclear respiratory factor 1 (NRF1), a transcription factor that plays a crucial role in regulating the expression of genes involved in cellular energy metabolism and mitochondrial biogenesis. This antibody is highly specific, binding to the carbonyl group of lysine residues on NRF1 with high affinity.
GAD65 antibody
GAD65 antibody is a polyclonal antibody that is commonly used in Life Sciences research. This antibody specifically targets the enzyme glutamate decarboxylase 65 (GAD65). GAD65 plays a crucial role in the synthesis of gamma-aminobutyric acid (GABA), an inhibitory neurotransmitter in the central nervous system. The cytotoxic effects of GAD65 antibodies have been studied in various research models, including androgen-treated prostate cancer cells, where it was found to inhibit cell proliferation and induce apoptosis.
CEP55 antibody
CEP55 antibody was raised using the N terminal of CEP55 corresponding to a region with amino acids MSSRSTKDLIKSKWGSKPSNSKSETTLEKLKGEIAHLKTSVDEITSGKGK
IRF2BP1 antibody
IRF2BP1 antibody was raised using the middle region of IRF2BP1 corresponding to a region with amino acids LVARNGEAEVSPTAGAEAVSGGGSGTGATPGAPLCCTLCRERLEDTHFVQ
PDE4D antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug belonging to the class of rifamycins. It is specifically designed to combat tuberculosis infections by targeting active compounds and exhibiting bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, preventing transcription and replication, thus inhibiting bacterial growth. Its efficacy has been extensively studied using advanced techniques like transcription-quantitative polymerase chain and patch-clamp technique. Additionally, it undergoes various metabolic transformations such as hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Furthermore, it specifically targets markers expressed in Mycobacterium tuberculosis strains, inhibiting their growth in culture.
Annexin I antibody
The Annexin I antibody is a valuable tool in the field of Life Sciences. It is available in both polyclonal and monoclonal forms, providing researchers with options to suit their specific needs. This antibody has been extensively tested and proven to be highly effective in a variety of applications.
PELI1 antibody
The PELI1 antibody is an anti-HER2 antibody that plays a crucial role in endocytic uptake. It is widely used in the field of Life Sciences for various applications. This antibody specifically targets HER2, a protein that is overexpressed in certain cancer cells, including breast cancer. By binding to HER2, the PELI1 antibody inhibits its signaling pathway and prevents the growth and proliferation of cancer cells.
Keratin K4 antibody
Keratin K4 antibody was raised in Guinea Pig using synthetic peptide of human keratin K4 coupled to KLH as the immunogen.
Purity:Min. 95%Ketamine antibody
Ketamine antibody is a monoclonal antibody that specifically targets sclerostin, a protein involved in bone metabolism. This antibody can be used in various assays to detect and quantify sclerostin levels in biological samples. The high specificity and sensitivity of this antibody make it an ideal tool for research in the field of bone biology and related diseases. Additionally, the colloidal gold conjugation of this antibody allows for easy visualization and detection in immunoassays. Whether you are studying the role of sclerostin in osteoporosis or investigating potential therapeutic interventions, this ketamine antibody is an essential tool for your research.
Phosphothreonine antibody (biotin)
Phosphothreonine antibody (biotin) was raised in rabbit using phosphothreonine-KLH and phosvitin mixture as the immunogen.
Denosumab
CAS:Monoclonal antibody against RANKL; anti-resorptive agent for osteoperosis treatment
Purity:(Sec-Hplc) Min. 95 Area-%Color and Shape:Clear LiquidRef: 3D-BD165585
Discontinued productDengue Virus Type 1 Envelope Antigen, Recombinant
Please enquire for more information about Dengue Virus Type 1 Envelope Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page
Purity:Min. 95%CA 125 antibody (biotin)
CA 125 antibody (biotin) was raised in mouse using affinity pure human CA 125 antigen as the immunogen.
