Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,620 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(751 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,551 products)
- Metabolism Antibodies(279 products)
- Microbiology Antibodies(739 products)
- Signal Transduction(2,717 products)
- Tags & Cellular Markers(33 products)
Found 75447 products of "Primary Antibodies"
Prothrombin factor II antibody (HRP)
Prothrombin factor II antibody (HRP) was raised in sheep using human Prothrombin purified from plasma as the immunogen.GOT1 antibody
GOT1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MAPPSVFAEVPQAQPVLVFKLTADFREDPDPRKVNLGVGAYRTDDCHPWV
SMAD4 antibody
The SMAD4 antibody is a highly effective inhibitor that targets the histidine-rich region of the human serum. It specifically blocks the activity of growth factors, preventing their binding to receptors and subsequent signaling pathways. This monoclonal antibody has been extensively studied and proven to be nephrotoxic in various experimental models. Additionally, it has shown promising results in inhibiting the epidermal growth factor pathway, making it a potential therapeutic option for diseases associated with its overactivation.
FOXP2 antibody
The FOXP2 antibody is a highly specialized microparticle used in Life Sciences research. It is a polyclonal antibody that specifically targets the FOXP2 protein, which plays a crucial role in various cellular processes. This antibody can be used in applications such as transcription-polymerase chain reaction (PCR), interferon assays, and antigen-antibody reactions.
Purity:Min. 95%ABCC11 antibody
ABCC11 antibody was raised using a synthetic peptide corresponding to a region with amino acids NSKIILIDEATASIDMETDTLIQRTIREAFQGCTVLVIAHRVTTVLNCDH
Purity:Min. 95%BTBD10 antibody
BTBD10 antibody was raised using a synthetic peptide corresponding to a region with amino acids AGRPHPYDGNSSDPENWDRKLHSRPRKLYKHSSTSSRIAKGGVDHTKMSL
Fibrinopeptide A antibody
Fibrinopeptide A antibody was raised in mouse using Fibrinopeptide A conjugated with carrier protein as the immunogen.
SEMA3D antibody
SEMA3D antibody was raised using the middle region of SEMA3D corresponding to a region with amino acids LECIPKSQQATIKWYIQRSGDEHREELKPDERIIKTEYGLLIRSLQKKDS
Purity:Min. 95%CRP antibody
CRP antibody was raised in mouse using human CRP derived from pleural/ascetic fluid or plasma as the immunogen.
ZHX2 antibody
The ZHX2 antibody is a powerful tool used in the field of Life Sciences. It specifically targets and binds to collagen, a protein found abundantly in the body. This antibody has shown antinociceptive properties, meaning it can help alleviate pain sensations. Additionally, it has been observed to be effective in inhibiting the activation of certain phosphorylation sites, which play a crucial role in cellular signaling pathways.
Purity:Min. 95%Bbs1 antibody
Bbs1 antibody was raised in rabbit using the N terminal of Bbs1 as the immunogen
Purity:Min. 95%KIF5B antibody
KIF5B antibody was raised using the C terminal of KIF5B corresponding to a region with amino acids ANEVKQAVEQQIQSHRETHQKQISSLRDEVEAKAKLITDLQDQNQKMMLE
Purity:Min. 95%Goat anti Rabbit IgG (H + L) (FITC)
Goat anti-rabbit IgG (H + L) (FITC) was raised in goat using rabbit IgG, (H&L) as the immunogen.
Estrogen Receptor alpha antibody (Ser106)
Rabbit Polyclonal Estrogen Receptor alpha antibody (Ser106)
GSG1 antibody
GSG1 antibody was raised using the C terminal of GSG1 corresponding to a region with amino acids VGPLTSYHQYHNQPIHSVSEGVDFYSELRNKGFQRGASQELKEAVRSSVE
Purity:Min. 95%Donkey anti Goat IgG (H + L)
This antibody reacts with heavy chains on Goat IgG and light chains on all Goat immunoglobulins.Purity:Min. 95%GCLM antibody
GCLM antibody was raised using the middle region of GCLM corresponding to a region with amino acids KPNSNQVNLASCCVMPPDLTAFAKQFDIQLLTHNDPKELLSEASFQEALQ
CD45 antibody
CD45 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.
Purity:Min. 95%p73 antibody
The p73 antibody is a highly specialized polyclonal antibody used in the field of Life Sciences. It is designed to specifically target and bind to the p73 protein, which plays a crucial role in various cellular processes including cell growth, differentiation, and apoptosis. This antibody has been extensively tested and validated for its high specificity and sensitivity.
Purity:Min. 95%GLUT4 antibody
The GLUT4 antibody is a glycoprotein that plays a crucial role in glucose metabolism. It is activated by androgen and protein kinase, leading to the translocation of GLUT4 from intracellular vesicles to the plasma membrane. This enables the uptake of glucose into cells, regulating blood sugar levels. The GLUT4 antibody can be used for various applications, including research in human serum, detection of autoantibodies, growth factor studies, anti-angiogenesis research, and as an essential tool for the development of antibodies in Life Sciences. With both polyclonal and monoclonal antibodies available, this product provides researchers with reliable options for their experiments. Additionally, it can be used as an inhibitor to study the function and regulation of GLUT4 in different cellular processes.
Purity:Min. 95%cSRC antibody
The cSRC antibody is a valuable tool in the field of Life Sciences. It is widely used as an inhibitor for 6-phosphogluconate dehydrogenase, an enzyme involved in glucose metabolism. This antibody specifically targets and binds to the phosphorylation site of cSRC, a protein kinase that plays a crucial role in cell signaling pathways.
Purity:Min. 95%Myc Tag antibody
The Myc Tag antibody is a highly specific monoclonal antibody that is widely used in life sciences research. It is designed to specifically recognize and bind to the Myc epitope tag, a small peptide sequence derived from the c-myc gene. This antibody has been extensively validated for its high affinity and specificity in detecting proteins tagged with the Myc epitope.
