Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,620 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(751 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,551 products)
- Metabolism Antibodies(279 products)
- Microbiology Antibodies(739 products)
- Signal Transduction(2,717 products)
- Tags & Cellular Markers(33 products)
Found 75447 products of "Primary Antibodies"
GPR81 antibody
The GPR81 antibody is a powerful tool used in Life Sciences research. It is a polyclonal antibody that specifically targets GPR81, a receptor involved in various cellular processes. This antibody has been extensively validated through cytotoxic assays and transcription-polymerase chain reaction (PCR) experiments.
HE4 antibody
The HE4 antibody is a monoclonal antibody that specifically targets human serum. It is designed to inhibit the activity of dimers in the nuclear protein complex. This antibody has been extensively studied in the field of Life Sciences and has shown promising results in various applications. It has been found to be effective in inhibiting interleukin-6, a pro-inflammatory cytokine, as well as other antibodies involved in immune responses. Additionally, the HE4 antibody has been shown to activate creatine kinase, an enzyme involved in energy metabolism, and modulate chemokine signaling pathways. Its unique properties make it a valuable tool for researchers and scientists working in various fields of study.Factor VII antibody
Factor VII antibody is a polyclonal antibody that targets the activated form of factor VII, a surface glycoprotein involved in the coagulation cascade. This antibody has been widely used in life sciences research to study the role of factor VII in various physiological processes. It has been shown to inhibit factor VII activity and gluconeogenesis in vitro. Additionally, this antibody has been used as a tool in multi-agent chemotherapy studies to investigate its potential therapeutic effects. Factor VII antibody can be used in various applications such as immunoassays, electrophoresis, and Western blotting to detect and quantify factor VII levels in samples. Its high specificity and sensitivity make it an essential tool for researchers studying coagulation pathways and related disorders.
CDC2 antibody
The CDC2 antibody is a highly specialized antibody used in the field of Life Sciences. It is derived from blood monocytes and is available as both polyclonal and monoclonal antibodies. The CDC2 antibody is commonly used in research laboratories to study various cellular processes and pathways.
GAPDH antibody
The GAPDH antibody is a highly specialized monoclonal antibody used in Life Sciences research. It plays a crucial role in various applications such as immunoblotting, immunoprecipitation, and immunohistochemistry. This antibody specifically targets the glyceraldehyde-3-phosphate dehydrogenase (GAPDH) enzyme, which is involved in glycolysis and other metabolic pathways.
ARAF antibody
The ARAF antibody is a highly specialized monoclonal antibody that targets and neutralizes the ARAF protein. This protein plays a crucial role in cell growth and division, making it an important target for cancer therapy. The ARAF antibody binds to the ARAF protein, preventing its activation and inhibiting tumor growth.
N Cadherin antibody
The N Cadherin antibody is a trifunctional antibody that has various applications in the field of Life Sciences. It can be used for research purposes, such as studying growth factors and their interactions with human serum. This antibody is commonly used in laboratory settings and can be used in experiments involving electrodes and other scientific equipment.
RG9MTD2 antibody
RG9MTD2 antibody was raised using a synthetic peptide corresponding to a region with amino acids EDLIYLTSDSPNILKELDESKAYVIGGLVDHNHHKGLTYKQASDYGINHA
BRAF antibody
BRAF antibody was raised in Mouse using a purified recombinant fragment of BRAF expressed in E. coli as the immunogen.MVD antibody
The MVD antibody is a highly specialized monoclonal antibody that targets the protein MVD (mevalonate diphosphate decarboxylase). This antibody is commonly used in Life Sciences research to study the function and regulation of MVD in various biological processes. It has been shown to interact with interleukin-6, chemokines, and nuclear proteins, indicating its involvement in immune responses and cellular signaling pathways.
Complement factor H antibody
The Complement factor H antibody is a highly specialized antibody that plays a crucial role in the regulation of the immune system. It binds to glutamate and other molecules to prevent excessive activation of the complement system, which can lead to inflammation and tissue damage. This antibody is widely used in life sciences research, particularly in studies related to insulin, lipoprotein lipase, and heparin-induced thrombocytopenia. It is also used as a diagnostic tool for detecting insulin antibodies and as a therapeutic agent for targeting growth factors such as trastuzumab and epidermal growth factor. With its high specificity and affinity for its target molecules, this monoclonal antibody is an essential component in many medicaments and has proven to be invaluable in various research applications.
AURKA antibody
The AURKA antibody is a monoclonal antibody that targets glial fibrillary acidic protein (GFAP). It is commonly used in research and diagnostics to detect the presence of GFAP, which is an important marker for astrocytes. This antibody can be used in various applications, including immunohistochemistry, western blotting, and flow cytometry. Additionally, it has been shown to be effective in detecting amyloid plaques in Alzheimer's disease brain tissue. The AURKA antibody is also useful for studying the role of protein kinases in cellular processes, as it specifically targets Aurora kinase A (AURKA). It can be used as a tool to inhibit the activity of AURKA and study its downstream effects on cell division and proliferation. In summary, the AURKA antibody is a valuable tool for researchers in the life sciences field who are studying various aspects of cellular biology and disease mechanisms.
GCNT3 antibody
GCNT3 antibody was raised using a synthetic peptide corresponding to a region with amino acids AICVYGAGDLNWMLQNHHLLANKFDPKVDDNALQCLEEYLRYKAIYGTEL
FZD9 antibody
FZD9 antibody was raised using a synthetic peptide corresponding to a region with amino acids RPPGDLGPGAGGSGTCENPEKFQYVEKSRSCAPRCGPGVEVFWSRRDKDF
Desmin antibody
The Desmin antibody is an important tool in the field of Life Sciences. It is a monoclonal antibody that specifically targets Desmin, a protein involved in muscle cell structure and function. This antibody has been widely used in research to study the role of Desmin in various biological processes.
ALDH1A2 antibody
The ALDH1A2 antibody is a highly specialized product in the field of Life Sciences and Antibodies. It is specifically designed to target and interact with ALDH1A2, a growth factor that plays a crucial role in various biological processes. This antibody has been extensively tested and validated for its effectiveness in detecting and quantifying ALDH1A2 levels.
p53 antibody
The p53 antibody is a highly effective inhibitor used in Life Sciences research. This monoclonal antibody specifically targets and neutralizes the p53 protein, which plays a crucial role in regulating cell growth and preventing tumor formation. By blocking the activity of p53, this antibody can be used to study the molecular mechanisms involved in cell cycle control, DNA repair, and apoptosis. Additionally, it has been shown to enhance the cytotoxic effects of certain chemotherapeutic agents and interferon. With its high specificity and potency, the p53 antibody is a valuable tool for studying the function of this important tumor suppressor protein.
Legionella pneumophila antibody (HRP)
Legionella pneumophila antibody (HRP) was raised in rabbit using a whole cell preparation of Legionella pneumophila; ATCC #33152 as the immunogen.IL6 antibody
IL6 antibody is a highly effective therapeutic agent that targets interleukin-6 (IL-6), a key cytokine involved in inflammatory responses. IL-6 plays a crucial role in various physiological processes, including immune response and inflammation. This antibody specifically binds to IL-6, preventing its interaction with its receptors and inhibiting downstream signaling pathways.
Denosumab
CAS:Monoclonal antibody against RANKL; anti-resorptive agent for osteoperosis treatment
Purity:(Sec-Hplc) Min. 95 Area-%Color and Shape:Clear LiquidRef: 3D-BD165585
Discontinued productDengue Virus Type 1 Envelope Antigen, Recombinant
Please enquire for more information about Dengue Virus Type 1 Envelope Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page
Purity:Min. 95%CA 125 antibody (biotin)
CA 125 antibody (biotin) was raised in mouse using affinity pure human CA 125 antigen as the immunogen.
