Primary Antibodies

Podoplanin antibody was raised in mouse using gp36 (podoplanin)-expressing MDCK cells as the immunogen.

The FGF1 antibody is a powerful globulin that acts as a family kinase inhibitor, specifically targeting endothelial growth. This antibody is widely used in the field of Life Sciences and is highly effective in inhibiting cdk4/6, a crucial enzyme involved in cell cycle regulation. Additionally, the FGF1 antibody has shown remarkable neutralizing properties against caspase-9, an enzyme responsible for initiating apoptosis. With its polyclonal nature, this antibody exhibits high specificity and affinity towards alpha-fetoprotein, making it an ideal tool for research involving adipose tissue. Furthermore, the FGF1 antibody has demonstrated antiviral activity and can effectively target molecules associated with viral infections. Its colloidal formulation ensures stability and ease of use. Researchers also utilize this antibody as an anti-VEGF agent due to its ability to counteract vascular endothelial growth factor.

The QSOX1 antibody is a monoclonal antibody that plays a crucial role in neutralizing the growth factor and steroid histidine. It is widely used in Life Sciences for its ability to target and bind to specific antigens, facilitating various research applications. This high-quality antibody is produced through hybridization techniques, ensuring its specificity and efficacy. The QSOX1 antibody has shown promising results in studies related to enzastaurin, dopamine, and natriuretic factors. It can also be utilized for the detection of autoantibodies and antigen-antibody reactions. With its exceptional binding capabilities, this monoclonal antibody is an invaluable tool for researchers in the field of Life Sciences.

Affinity purified Rabbit polyclonal Nucleoporin p62 antibody

The NRF1 antibody is a powerful tool used in life sciences research. It specifically targets the nuclear respiratory factor 1 (NRF1), a transcription factor that plays a crucial role in regulating the expression of genes involved in cellular energy metabolism and mitochondrial biogenesis. This antibody is highly specific, binding to the carbonyl group of lysine residues on NRF1 with high affinity.

EHMT2 antibody was raised in Rabbit using Human EHMT2 as the immunogen

The CacyBP antibody is a powerful tool in the field of Life Sciences. It is an anti-mesothelin antibody that has been extensively studied for its potential therapeutic applications. Mesothelin is a cell surface glycoprotein that is highly expressed in various cancers, making it an attractive target for cancer therapy.

Mouse monoclonal EMA antibody (biotin conjugated)

MLF2 antibody was raised in Rabbit using Human MLF2 as the immunogen

The SOCS2 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It specifically targets and binds to the activated form of the steroid hormone cortisol. This antibody is commonly used in studies investigating the role of cortisol in various biological processes, including growth factor signaling pathways. By blocking the action of cortisol, the SOCS2 antibody can help researchers understand the mechanisms by which this hormone influences cell function and development.

6-Fluoro-3-indoxyl-beta-D-galactopyranoside:

IDH3A antibody was raised using a synthetic peptide corresponding to a region with amino acids RHMGLFDHAARIEAACFATIKDGKSLTKDLGGNAKCSDFTEEICRRVKDL

OSMR antibody was raised using the middle region of OSMR corresponding to a region with amino acids LLEKKTGYSQELAPSDNPHVLVDTLTSHSFTLSWKDYSTESQPGFIQGYH

Guinea pig polyclonal Hemoglobin antibody (HRP)

SURF1 antibody was raised in rabbit using the N terminal of SURF1 as the immunogen

TIP47 antibody was raised in guinea pig using synthetic peptide of TIP47 N-terminus as the immunogen.

Affinity purified Rabbit polyclonal BIRC7 antibody

DDT antibody was raised using the N terminal of DDT corresponding to a region with amino acids PFLELDTNLPANRVPAGLEKRLCAAAASILGKPADRVNVTVRPGLAMALS

Affinity purified Rabbit polyclonal BCL2L12 antibody

CD5 (FITC) antibody was raised in rat using CD5/Lyt-1 as the immunogen.

The Hsp90 antibody is a polyclonal antibody that is widely used in life sciences research. It is commonly used in vitro assays to detect and quantify the presence of Hsp90, a protein that plays a crucial role in cellular processes. This antibody specifically recognizes the Hsp90 protein by binding to specific amino acid residues on its surface.

VAX2 antibody was raised in mouse using recombinant Human Ventral Anterior Homeobox 2 (Vax2)

The SMAD2 antibody is a highly specialized biomolecule that plays a crucial role in the field of Life Sciences. This monoclonal antibody is designed to specifically target and neutralize SMAD2, a key protein involved in various cellular processes. It has been extensively studied for its potential applications in research and therapeutic settings.

The Fatty Acid Synthase antibody is a highly specialized protein used in Life Sciences research. It is an essential tool for studying the role of fatty acid synthesis in various biological processes. This antibody specifically targets and neutralizes proteins involved in the synthesis of fatty acids, such as TNF-α, interleukin-6, and chemokines.

Rabbit polyclonal GABRA5 antibody

TRPM5 antibody was raised using the N terminal of TRPM5 corresponding to a region with amino acids EKHISEQRAGYGGTGSIEIPVLCLLVNGDPNTLERISRAVEQAAPWLILV

The SNAP23 antibody is a monoclonal antibody that specifically targets the protein SNAP23. This protein plays a crucial role in various cellular processes, including vesicle fusion and membrane trafficking. The SNAP23 antibody can be used in Life Sciences research to study the function of SNAP23 and its interactions with other proteins.

Affinity purified Rabbit polyclonal NPRC antibody

CCDC158 antibody was raised in Rabbit using Human CCDC158 as the immunogen

The CYTL1 antibody is a highly specialized antibody that plays a crucial role in various biological processes. It belongs to the class of polyclonal antibodies and is specifically designed to target and neutralize the effects of CYTL1.

Rabbit polyclonal U1A antibody (biotin)

The RAD52 antibody is a highly specialized product used in the field of Life Sciences. It is a polyclonal antibody that specifically targets the RAD52 protein, which plays a crucial role in DNA repair and recombination processes. This antibody is widely used in various biochemical and industrial applications.

Affinity purified Rabbit polyclonal Dipeptidyl peptidase 3 antibody

MKRN1 antibody was raised using the N terminal of MKRN1 corresponding to a region with amino acids GDRCRYEHSKPLKQEEATATELTTKSSLAASSSLSSIVGPLVEMNTGEAE

The SH1 antibody is a polyclonal antibody that has been developed as a potential biological tool for studying tumor biomarkers. It specifically targets the IL-17A antigen, which is known to be involved in various protein-protein interactions and signaling pathways. The SH1 antibody can be used in various life science applications, including immunohistochemistry, western blotting, and ELISA assays. It has been shown to exhibit strong inhibition effects on IL-17A activity in vitro and in vivo. The SH1 antibody is produced using a eukaryotic expression vector and synthetic techniques, ensuring high purity and specificity. With its unique characteristics and versatility, the SH1 antibody is an essential tool for researchers investigating IL-17A-related pathways and exploring potential therapeutic interventions.

The ITGB3 antibody is a highly specialized polyclonal antibody that acts as a family kinase inhibitor. It is designed to target and neutralize specific factors in the body, making it an effective antiviral and factor antagonist. This antibody also serves as a cdk4/6 inhibitor, inhibiting the activity of cyclin-dependent kinases 4 and 6.

The C5 antibody is a powerful tool in the field of Life Sciences. It is a polyclonal antibody that specifically targets the glucose transporter on actin filaments. This antibody has been extensively studied and proven to be highly effective in various applications.

Cytokeratin 10 antibody is a highly specialized monoclonal antibody that targets the glycoprotein Cytokeratin 10. It is used for its neutralizing properties in various applications such as immunohistochemistry and Western blotting. This antibody has been extensively tested and validated to ensure its high specificity and sensitivity. It can effectively detect Cytokeratin 10 expression in adipose tissues, human serum, and other biological samples. Additionally, it has been shown to have cytotoxic effects on certain cancer cells when used in combination with active agents like Sn-38. With its exceptional binding affinity and ability to inhibit the activity of Cytokeratin 10, this antibody is a valuable tool for researchers studying autoimmune diseases, cancer biology, and interferon signaling pathways. Whether you are conducting basic research or developing diagnostic assays, this Cytokeratin 10 antibody will provide reliable and accurate results.

Rabbit polyclonal SLC32A1 antibody

The Arginase I antibody is a highly effective monoclonal antibody that targets the protein complex responsible for the breakdown of arginine. It has been shown to have excellent colloidal properties, making it ideal for use in various applications. This antibody specifically binds to extracellular polysaccharides and can be used in both research and diagnostic settings.

IL13 antibody (biotin) was raised in rabbit using highly pure recombinant hIL-13 as the immunogen.

Rabbit polyclonal PSMB1 antibody

Please enquire for more information about HBsAg Mouse Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page

Please enquire for more information about Dengue Virus Type 1 Envelope Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page

Monoclonal antibody against RANKL; anti-resorptive agent for osteoperosis treatment

CA 125 antibody (biotin) was raised in mouse using affinity pure human CA 125 antigen as the immunogen.

Cortisol antibody was raised in mouse using cortisol-3 BSA as the immunogen.