Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,620 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(751 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,709 products)
- Metabolism Antibodies(279 products)
- Microbiology Antibodies(738 products)
- Signal Transduction(2,717 products)
- Tags & Cellular Markers(33 products)
Found 75327 products of "Primary Antibodies"
TRIM5 alpha antibody
TRIM5 alpha antibody was raised in Mouse using a purified recombinant fragment of human TRIM5 alpha expressed in E. coli as the immunogen.
CD45.1 antibody (Spectral Red)
CD45.1 antibody (Spectral Red) was raised in mouse using CD45.1 as the immunogen.
Purity:Min. 95%AKR1C2 antibody
The AKR1C2 antibody is a highly specialized protein that plays a crucial role in various biological processes. It has been extensively studied in the field of Life Sciences and has shown significant potential in research and therapeutic applications.
C13orf30 antibody
C13orf30 antibody was raised using the N terminal of C13orf30 corresponding to a region with amino acids MGQNWKRQQKLWNVPQLPFIRVPPSIYDTSLLKALNQGQQRYFYSIMRIY
5HT2C antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an antituberculosis drug that belongs to the class of rifamycins. It is known for its bactericidal activity against tuberculosis infection. This active compound inhibits bacterial growth by binding to DNA-dependent RNA polymerase, preventing transcription and replication. It has been extensively studied using advanced techniques like transcription-quantitative polymerase chain and patch-clamp technique. The drug undergoes various metabolic transformations, including hydrolysis, oxidation, reduction, and conjugation. Additionally, it specifically targets markers expressed in Mycobacterium tuberculosis strains and inhibits cell growth in culture.
COPG antibody
COPG antibody was raised using the N terminal of COPG corresponding to a region with amino acids MLKKFDKKDEESGGGSNPFQHLEKSAVLQEARVFNETPINPRKCAHILTK
Aml1 antibody
The Aml1 antibody is a powerful tool in the field of immunology. It is an antibody that specifically targets and neutralizes the activity of ACTH, a hormone involved in various physiological processes. This antibody has been extensively studied and proven to be highly effective in inhibiting the growth and proliferation of Mycoplasma genitalium, a common pathogen responsible for several sexually transmitted infections. Additionally, the Aml1 antibody has been shown to block the activity of TGF-beta, a potent growth factor involved in tissue repair and fibrosis. Its cytotoxic properties make it an excellent candidate for targeted cancer therapy, as it can induce cell lysis in tumor cells while sparing healthy cells. Furthermore, this monoclonal antibody has demonstrated its ability to bind to collagen, providing potential applications in wound healing and tissue engineering. Overall, the Aml1 antibody is a versatile tool with numerous potential applications in research and therapeutic development.
Purity:Min. 95%ALAD antibody
ALAD antibody was raised using the N terminal of ALAD corresponding to a region with amino acids EEMLRPLVEEGLRCVLIFGVPSRVPKDERGSAADSEESPAIEAIHLLRKT
GCLC antibody
GCLC antibody was raised using the N terminal of GCLC corresponding to a region with amino acids VLETLQEKGERTNPNHPTLWRPEYGSYMIEGTPGQPYGGTMSEFNTVEAN
CD171 antibody
The CD171 antibody is a monoclonal antibody that specifically targets the alpha-synuclein antigen. It is widely used in Life Sciences research to study the role of alpha-synuclein in various diseases and conditions. The CD171 antibody binds to specific epitopes on alpha-synuclein, allowing researchers to detect and analyze its presence in samples. This antibody is highly sensitive and can be used for both qualitative and quantitative analysis. Additionally, it has been shown to have a high affinity for soluble forms of alpha-synuclein, making it a valuable tool for studying its distribution and localization in tissues and body fluids. The CD171 antibody can be used in various techniques such as immunohistochemistry, Western blotting, ELISA, and polymerase chain reaction (PCR) assays. Its use has contributed significantly to our understanding of alpha-synuclein-related diseases and may have potential applications in diagnostics and therapeutics development.
PAPOLG antibody
PAPOLG antibody was raised using a synthetic peptide corresponding to a region with amino acids SVDAIGGESMPIPTIDTSRKKRLPSKELPDSSSPVPANNIRVIKNSIRLT
alpha 1 Antiplasmin antibody
alpha 1 Antiplasmin antibody was raised in goat using human alpha 1 Antiplasmin purified from plasma as the immunogen.
Purity:Min. 95%DDX24 antibody
DDX24 antibody was raised using a synthetic peptide corresponding to a region with amino acids ELRHLLSQPLFTESQKTKYPTQSGKPPLLVSAPSKSESALSCLSKQKKKK
Granzyme B antibody (PE)
Granzyme B antibody (PE) was raised in mouse using human granzyme B as the immunogen.
Tetracycline antibody
The Tetracycline antibody is a highly specific monoclonal antibody that binds to tetracycline, a broad-spectrum antibiotic. This antibody has a high receptor binding affinity and can be used in various applications, such as polymerase chain reactions (PCR), immunohistochemistry, and Western blotting. It specifically targets tetracycline residues in biological samples, allowing for the detection and quantification of this antibiotic. In addition to its use in research, the Tetracycline antibody has potential applications in the field of medicine. It can be used to study the cellular localization of tetracycline within cells or tissues, providing valuable insights into its mechanism of action. Furthermore, this antibody can be utilized to investigate protein-protein interactions involving tetracycline or its derivatives. The Tetracycline antibody is produced using advanced techniques in monoclonal antibody production. It exhibits high specificity and sensitivity, ensuring reliable and accurate results. This antibody is compatible with various sample types, including
Purity:≥90%
