Primary Antibodies

The TRIM24 antibody is a highly effective neutralizing agent that targets actin filaments and fibrinogen in Life Sciences research. It is commonly used in immunoassays to detect and quantify specific proteins of interest. This monoclonal antibody, derived from colloidal gold particles, exhibits high specificity and sensitivity in detecting target molecules. It can be used for various applications including Western blotting, ELISA, immunohistochemistry, and flow cytometry. The TRIM24 antibody has been extensively validated and proven to provide reliable results in research experiments. Its unique properties make it an essential tool for scientists studying protein interactions, signal transduction pathways, and cellular processes. With its exceptional performance, this antibody offers researchers the opportunity to gain valuable insights into the molecular mechanisms underlying various diseases and biological phenomena.

KLHDC8A antibody was raised using the C terminal of KLHDC8A corresponding to a region with amino acids PGKNKWEILPAMPTPRCACSSIVVKNCLLAVGGVNQGLSDAVEALCVSDS

The KLKB1 antibody is a highly effective medicament used in the field of life sciences. It is widely recognized for its ability to detect and analyze colony-stimulating factors in blood plasma. This Polyclonal Antibody has shown remarkable results in various research studies, including electrochemical impedance spectroscopy and cytometry analysis. Its reactive properties make it an ideal tool for investigating messenger RNA expression and leukocyte antigen activity. Additionally, the KLKB1 antibody has demonstrated cytotoxic effects on target cells, making it a valuable asset in the study of cellular mechanisms. With its adeno-associated viral delivery system, this antibody offers a promising avenue for therapeutic applications.

Rabbit polyclonal VPS52 antibody

Rabbit polyclonal ATF6B antibody

ZGPAT antibody was raised using the middle region of ZGPAT corresponding to a region with amino acids LLREAVVEGDGILPPLRTEATESDSDSDGTGDSSYARVVGSDAVDSAQSS

Rabbit polyclonal p53 antibody (Ser376)

TNF Receptor 1 antibody is a highly effective monoclonal antibody used in the field of Life Sciences. It is specifically designed to neutralize the activity of TNF receptor 1, a cell surface protein involved in various cellular processes. This antibody acts as a potent inhibitor of TNF receptor 1 signaling, which plays a crucial role in inflammation and immune response. The TNF Receptor 1 antibody has been extensively studied and proven to be effective in inhibiting the growth factor-induced activation of downstream pathways. It has also shown promising results in preclinical studies targeting diseases such as cancer and autoimmune disorders. With its high specificity and cytotoxic properties, this antibody holds great potential for therapeutic applications in targeted therapy. Whether used alone or in combination with other antibodies such as anti-VEGF or tyrosinase inhibitors, TNF Receptor 1 antibody offers a promising avenue for researchers and clinicians alike in their quest to combat various diseases effectively.

MAP2K3 antibody was raised using the C terminal of MAP2K3 corresponding to a region with amino acids EEPSPQLPADRFSPEFVDFTAQCLRKNPAERMSYLELMEHPFFTLHKTKK

Rabbit polyclonal MED13L antibody

Akt, also known as Protein Kinase B (PKB), is a serine/threonine-specific kinase crucial for regulating key cellular functions, including growth, survival, metabolism, and proliferation. It operates within the PI3K/Akt/mTOR pathway, which integrates external signals to maintain cellular function and adaptation. Humans express three Akt isoforms—Akt1, Akt2, and Akt3—each encoded by a distinct gene. The activation of Akt generally starts when external signals like growth factors or insulin bind to cell surface receptors, activating phosphoinositide 3-kinase (PI3K). This leads to the production of phosphatidylinositol (3,4,5)-trisphosphate (PIP3) on the cell membrane, which attracts Akt to the membrane, where it undergoes phosphorylation at two specific sites, Thr308 and Ser473, to become fully active. Once activated, Akt moves through the cell to phosphorylate target proteins involved in various cellular pathways.The primary functions of Akt include promoting cell survival by inhibiting apoptosis through the inactivation of pro-apoptotic proteins like BAD and Caspase-9. It also supports cell growth and proliferation by activating mTOR, a central regulator of protein synthesis, while suppressing growth-arrest pathways. Akt plays a key role in metabolic regulation by increasing glucose uptake and glycolysis, largely through GLUT4 translocation and hexokinase activation, which is particularly important in muscle and fat tissues. It contributes to angiogenesis by upregulating VEGF expression, aiding tissue growth and repair, and it promotes cell migration, facilitating wound healing as well as the spread of cancer cells in malignancy. Due to its broad role in cell survival and growth, Akt is often hyperactivated in cancers, driving unchecked cell division and tumor growth, which makes the PI3K/Akt/mTOR pathway a target for many cancer therapies. Additionally, Akt's role in glucose metabolism links it to insulin signaling, where defects can impair glucose uptake, leading to insulin resistance and type 2 diabetes.

Mouse monoclonal GBA3 antibody

CD45.1 antibody (Spectral Red) was raised in mouse using CD45.1 as the immunogen.

Rabbit Polyclonal alpha Synuclein antibody (Ser129)

Rabbit polyclonal DBF4 antibody

Purified Rabbit polyclonal ERF antibody (Thr526)

Mannose 6-phosphate receptor antibody was raised in mouse using purified Bovine 300 kDa CI-MPR. as the immunogen.

Alpha-fetoprotein antibody is a monoclonal antibody that inhibits the activity of alpha-fetoprotein (AFP), a protein kinase involved in various biological processes. This antibody has been shown to neutralize the superoxide produced by AFP, thereby reducing its inhibitory effect on polymers and other enzymes. In addition, alpha-fetoprotein antibody has demonstrated anticancer activity by suppressing the growth and proliferation of cancer cells. This antibody is widely used in life sciences research and has potential applications in the development of targeted therapies for various diseases, including cancer. Furthermore, it has been found to have an inhibitory effect on collagen synthesis and may have implications for tissue repair and wound healing. With its unique properties and broad range of applications, alpha-fetoprotein antibody is an essential tool for scientists and researchers in the field of antibodies and molecular biology.

Purified Rabbit polyclonal CKLF3 antibody

EIF3C antibody was raised in Rabbit using Human EIF3C as the immunogen

Rabbit polyclonal Neuroglobin antibody (FITC)

Rabbit polyclonal LAMB1 antibody

Rabbit polyclonal AML1 antibody (Ser435)

The LSP1 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It specifically targets and binds to the collagen-activated isoenzyme of glucose-6-phosphate creatine kinase (G6PC). This antibody has been extensively studied and validated for its effectiveness in various applications, including the detection and quantification of G6PC in mesenchymal stem cells.

Tetanus toxin antibody is a monoclonal antibody that specifically targets and neutralizes the tetanus toxin. This antibody is derived from alpha-fetoprotein and has been extensively studied in the field of Life Sciences. It binds to the tetanus toxin, preventing it from binding to its target receptors and exerting its toxic effects. Additionally, this antibody has been shown to inhibit the activity of TGF-beta, a growth factor involved in various cellular processes. The binding proteins present in this antibody can effectively block the interaction between TGF-beta and its receptors, leading to the inhibition of downstream signaling pathways. Furthermore, studies have demonstrated that this monoclonal antibody can also bind to autoantibodies and other proteins involved in disease progression. With its high specificity and efficacy, tetanus toxin antibody holds great potential for therapeutic applications in various medical conditions.

Rabbit polyclonal TEX11 antibody

The Tetracycline antibody is a highly specific monoclonal antibody that binds to tetracycline, a broad-spectrum antibiotic. This antibody has a high receptor binding affinity and can be used in various applications, such as polymerase chain reactions (PCR), immunohistochemistry, and Western blotting. It specifically targets tetracycline residues in biological samples, allowing for the detection and quantification of this antibiotic. In addition to its use in research, the Tetracycline antibody has potential applications in the field of medicine. It can be used to study the cellular localization of tetracycline within cells or tissues, providing valuable insights into its mechanism of action. Furthermore, this antibody can be utilized to investigate protein-protein interactions involving tetracycline or its derivatives. The Tetracycline antibody is produced using advanced techniques in monoclonal antibody production. It exhibits high specificity and sensitivity, ensuring reliable and accurate results. This antibody is compatible with various sample types, including