Primary Antibodies
Primary antibodies are immunoglobulins that bind specifically to an antigen of interest, allowing for the detection and quantification of proteins, peptides, or other biomolecules. These antibodies are critical tools in a wide range of applications, including Western blotting, immunohistochemistry, and ELISA. At CymitQuimica, we offer an extensive selection of high-quality primary antibodies that provide specificity and sensitivity for various research needs, including cancer, immunology, and cell biology studies.
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,620 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(751 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,776 products)
- Metabolism Antibodies(279 products)
- Microbiology Antibodies(736 products)
- Signal Transduction(2,717 products)
- Tags & Cellular Markers(33 products)
Show 1 more subcategories
Found 75326 products of "Primary Antibodies"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
MARCKS antibody
<p>The MARCKS antibody is a genotoxic glycopeptide that is used in Life Sciences research. It is a monoclonal antibody that specifically targets the MARCKS protein. This protein plays a crucial role in cellular processes such as cell adhesion, migration, and signaling. The MARCKS antibody can be used to study the function and regulation of this protein in various biological systems.</p>PDS5B antibody
<p>PDS5B antibody was raised using a synthetic peptide corresponding to a region with amino acids DEQQWPEEKRLKEDILENEDEQNSPPKKGKRGRPPKPLGGGTPKEEPTMK</p>EGLN3 antibody
<p>EGLN3 antibody was raised using a synthetic peptide corresponding to a region with amino acids FWSDRRNPHEVQPSYATRYAMTVWYFDAEERAEAKKKFRNLTRKTESALT</p>STAT2 antibody
<p>The STAT2 antibody is a polyclonal antibody that targets the STAT2 molecule. It is commonly used in research and assays related to androgen signaling, low-density lipoprotein metabolism, autoantibodies, and inhibitors. This antibody has been shown to be effective in detecting and quantifying STAT2 expression in various cell types, including MCF-7 cells. In addition, it is widely used in life sciences research to study the regulation of cortisol concentration and the role of STAT2 in immune responses. The STAT2 antibody is a valuable tool for researchers looking to investigate the function and activation of this important signaling molecule.</p>C5ORF39 antibody
<p>C5ORF39 antibody was raised using the N terminal Of C5Orf39 corresponding to a region with amino acids EQHFLGCVKRAWDSAEVAPEPQPPPIVSSEDRGPWPLPLYPVLGEYSLDS</p>Peanut Protein Antibody
<p>The Peanut Protein Antibody is a monoclonal antibody that specifically targets peanut proteins. It is commonly used in the field of Life Sciences for various applications such as immunoassays and transcription-polymerase chain reaction (PCR). This antibody is highly sensitive and can detect even trace amounts of peanut protein in samples. It utilizes a particle chemiluminescence method to provide accurate and reliable results. The Peanut Protein Antibody has been extensively validated and proven to be reactive against a wide range of peanut proteins, making it an essential tool for researchers studying peanut allergies and related conditions. Additionally, this antibody has shown neutralizing activity against the allergenic properties of peanuts, making it a potential candidate for therapeutic applications. With its high specificity and sensitivity, the Peanut Protein Antibody is an indispensable tool for anyone working with peanut proteins in research or diagnostic settings.</p>CD40 antibody (Azide Free)
<p>CD40 antibody (Azide free) was raised in rat using CD40 as the immunogen</p>CD117 antibody
<p>The CD117 antibody is a monoclonal antibody that specifically targets the CD117 protein, also known as c-Kit. This protein is a receptor tyrosine kinase that plays a crucial role in the activation of endogenous hematopoietic stem cells. The CD117 antibody has been extensively studied and proven to be highly effective in neutralizing the activity of CD117.</p>Cortactin antibody
<p>The Cortactin antibody is a highly specialized monoclonal antibody that targets and binds to Cortactin, a protein that plays a crucial role in various cellular processes. This antibody has been extensively studied and proven to be effective in research related to adipose tissue, epidermal growth factor signaling, and even the pathogenesis of certain diseases such as amyloid plaque formation.</p>Purity:Min. 95%SPTLC2 antibody
<p>SPTLC2 antibody was raised using the N terminal of SPTLC2 corresponding to a region with amino acids VLTYVGYGVLTLFGYLRDFLRYWRIEKCHHATEREEQKDFVSLYQDFENF</p>TSSK2 antibody
<p>TSSK2 antibody was raised using the middle region of TSSK2 corresponding to a region with amino acids RMLQPDVSQRLHIDEILSHSWLQPPKPKATSSASFKREGEGKYRAECKLD</p>TSH beta antibody F(ab)'2 Fragment
<p>TSH beta antibody was raised against Human TSH (intact).</p>Purity:Min. 95%HSV2 gC antibody
<p>HSV2 gC antibody was raised in mouse using herpes simplex virus II glycoprotein C (gC) as the immunogen.</p>
