Primary Antibodies

<p>The FSH antibody is a highly specialized immunohistochemistry tool used in the field of Life Sciences. It specifically targets the tumor necrosis factor-alpha (TNF-α) and acts as a kinase receptor growth factor. This polyclonal antibody plays a crucial role in binding proteins and cytotoxicity, particularly against tyrosine kinase receptors.</p>

<p>PEX5 antibody was raised using the middle region of PEX5 corresponding to a region with amino acids LNMQRKSRGPRGEGGAMSENIWSTLRLALSMLGQSDAYGAADARDLSTLL</p>

<p>The VIM antibody is a highly specialized monoclonal antibody that targets and neutralizes the activity of interleukin-6 (IL-6), a key growth factor involved in various physiological processes. By inhibiting IL-6, the VIM antibody helps regulate immune responses and reduce inflammation. Additionally, this antibody has been shown to inhibit the production of superoxide, which plays a role in oxidative stress.</p>

<p>Mouse monoclonal HLAE antibody (PE)</p>

<p>Calibrator for Chicken ELISA Kit</p>

<p>Goat anti Human IgE antibody</p>

<p>CD30 antibody (FITC) was raised in hamster using recombinant murine CD30 extracellular domain-mouse IgG1 fusion protein as the immunogen.</p>

<p>The MEF2A antibody is a powerful tool used in Life Sciences research. It is an antibody that specifically targets and inhibits the activity of MEF2A, a transcription factor involved in various cellular processes. This polyclonal antibody is highly specific and can be used for a wide range of applications in research laboratories.</p>

<p>Goat polyclonal Human Ceruloplasmin antibody</p>

<p>SYT11 antibody was raised in rabbit using the N terminal of SYT11 as the immunogen</p>

<p>Testosterone 3 antibody was raised in rabbit using testosterone-3 BSA as the immunogen.</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections and contains active compounds that exhibit bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, preventing transcription and replication, thus inhibiting bacterial growth. Studies have shown its high frequency of human activity using a patch-clamp technique on human erythrocytes. The active form of this drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Moreover, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits their cell growth in culture.</p>

<p>TPTE antibody was raised using the C terminal of TPTE corresponding to a region with amino acids KILIDVFDGPPLYDDVKVQFFYSNLPTYYDNCSFYFWLHTSFIENNRLYL</p>

<p>MTUS1 antibody was raised using the N terminal of MTUS1 corresponding to a region with amino acids QLLACGNTKFEALTVVIQHLLSEREEALKQHKTLSQELVNLRGELVTAST</p>

<p>SEK1 antibody is a highly specialized product used in the field of Life Sciences. It is available as both polyclonal and monoclonal antibodies, offering researchers flexibility in their experiments. This antibody specifically targets glycopeptides, which are high polymers with glycosylation. It is commonly used for various applications, including the study of hormone peptides and intraocular processes.</p>

<p>Mouse monoclonal METTL21A antibody</p>

<p>CRP antibody was raised in mouse using human CRP as the immunogen.</p>

<p>CRP antibody was raised in mouse using human CRP derived from pleural/ascetic fluid or plasma as the immunogen.</p>

<p>This antibody reacts with heavy (mu) chains on mouse IgM.</p>

<p>VMAT2 antibody was raised in rabbit using a synthetic peptide from C-terminus of rat VMAT2 conjugated to BSA as the immunogen.</p>

<p>DYRK1B antibody was raised in Rabbit using Human DYRK1B as the immunogen</p>

<p>Mouse monoclonal MGLL antibody</p>

<p>GPR37L1 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>PDGFB antibody was raised using the N terminal of PDGFB corresponding to a region with amino acids NRCWALFLSLCCYLRLVSAEGDPIPEELYEMLSDHSIRSFDDLQRLLHGD</p>

<p>The PDE3B antibody is a protein-based product that belongs to the category of antibodies. It is specifically designed to target and bind to the PDE3B enzyme, which plays a crucial role in various cellular processes. This monoclonal antibody has been extensively tested and validated for its specificity and efficacy.</p>

<p>Purified Mouse anti-Human Procalcitonin antibody (Clone 1B12)</p>

<p>Rabbit anti-goat IgG (H + L) (Alk Phos) was raised in rabbit using goat IgG whole molecule as the immunogen.</p>

<p>The Tau antibody is a mouse monoclonal antibody that is widely used in Life Sciences research. It specifically binds to the peptide sequence of Tau protein, which plays a crucial role in neurodegenerative diseases such as Alzheimer's disease. This antibody has been extensively studied and validated for its high affinity and specificity towards Tau protein.</p>

<p>CEA antibody was raised in mouse using human colon adrenocarcinoma as the immunogen.</p>

<p>Granzyme B antibody (PE) was raised in mouse using human granzyme B as the immunogen.</p>

<p>HPV18 antibody was raised in mouse using papilloma virus type 18 as the immunogen.</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug belonging to the class of rifamycins. It is specifically designed to combat tuberculosis infection by targeting the active compounds responsible for bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, effectively preventing transcription and replication, thus inhibiting bacterial growth. The effectiveness of this drug has been extensively studied using advanced techniques such as the patch-clamp technique on human erythrocytes. Furthermore, it undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it binds specifically to markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits cell growth in culture.</p>

<p>Rabbit polyclonal virD2 antibody (HRP)</p>

<p>KRT16 antibody was raised in Rabbit using Human KRT16 as the immunogen</p>

<p>NECAP1 antibody was raised in Rabbit using Human NECAP1 as the immunogen</p>

<p>This Monoclonal anti-TGEV antibody is suitable for ELISA and blotting applications. Reactivity observed with CCV.</p>

<p>ELOF1 antibody was raised in rabbit using the middle region of ELOF1 as the immunogen</p>

<p>Affinity Purified Rabbit anti-Human Ferritin Antibody</p>

<p>FGF18 antibody is a polyclonal antibody that targets fibroblast growth factor 18 (FGF18). FGF18 is involved in various biological processes, including hepatocyte growth, tissue repair, and development. This antibody has been shown to have high specificity and affinity for FGF18, making it a valuable tool in life sciences research.</p>

<p>This antibody reacts with heavy (gamma) chains on mouse IgG and light chains on all mouse immunoglobulins.</p>

<p>LCP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids FIKIFHGLKSTDVAKTFRKAINKKEGICAIGGTSEQSSVGTQHSYSEEEK</p>

<p>Rabbit polyclonal PSMB7 antibody</p>

<p>Mouse monoclonal NHEJ1 antibody</p>

<p>Neurochondrin antibody was raised using the N terminal of NCDN corresponding to a region with amino acids MSCCDLAAAGQLGKASIMASDCEPALNQAEGRNPTLERYLGALREAKNDS</p>

<p>Calibrator for Cat ELISA Kit</p>

<p>The Caspase 1 antibody is a highly specialized antibody used in the field of Life Sciences. It targets caspase 1, an enzyme involved in various cellular processes such as apoptosis and inflammation. This antibody specifically recognizes and binds to caspase 1, allowing for its detection and analysis.</p>

<p>MFF antibody was raised in Rabbit using Human MFF as the immunogen</p>

<p>H, K ATPase antibody was raised in mouse using a 34kDa core peptide purified from deglycosylated hog gastric microsomes as the immunogen.</p>

<p>Rabbit polyclonal GDI2 antibody (biotin)</p>

<p>GNRHR antibody was raised in Rabbit using Human GNRHR as the immunogen</p>

<p>The CYP2A6 antibody is a monoclonal antibody that targets the protein kinase CYP2A6. This antibody can be used for various applications, including immunohistochemical detection and clinical use as a medicament. CYP2A6 is an enzyme that plays a crucial role in the metabolism of several compounds, including cotinine. It is also involved in the activation of procarcinogens and the detoxification of xenobiotics. The CYP2A6 antibody can be used to study the expression and localization of CYP2A6 in different tissues and cell types, making it a valuable tool in life sciences research. Additionally, this antibody may have potential applications in the development of novel antibacterial agents.</p>

<p>GRK5 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>Tetanus toxin antibody is a monoclonal antibody that specifically targets and neutralizes the tetanus toxin. This antibody is derived from alpha-fetoprotein and has been extensively studied in the field of Life Sciences. It binds to the tetanus toxin, preventing it from binding to its target receptors and exerting its toxic effects. Additionally, this antibody has been shown to inhibit the activity of TGF-beta, a growth factor involved in various cellular processes. The binding proteins present in this antibody can effectively block the interaction between TGF-beta and its receptors, leading to the inhibition of downstream signaling pathways. Furthermore, studies have demonstrated that this monoclonal antibody can also bind to autoantibodies and other proteins involved in disease progression. With its high specificity and efficacy, tetanus toxin antibody holds great potential for therapeutic applications in various medical conditions.</p>