Primary Antibodies

HTR1F antibody was raised in rabbit using the N terminal of HTR1F as the immunogen

Rabbit polyclonal TROAP antibody

Rabbit polyclonal FOS antibody (Thr232)

PRKAR1B antibody was raised using the middle region of PRKAR1B corresponding to a region with amino acids LNRPRAATVVARGPLKCVKLDRPRFERVLGPCSEILKRNIQRYNSFISLT

PRTFDC1 antibody was raised using the N terminal of PRTFDC1 corresponding to a region with amino acids AGSSEEAPDYGRGVVIMDDWPGYDLNLFTYPQHYYGDLEYVLIPHGIIVD

The SSRP1 antibody is a highly potent growth factor that acts as a phosphatase in various bioassays. It is specifically activated by human serum and has neutralizing properties. This antibody, widely used in Life Sciences research, targets tyrosine kinase receptors and 3-kinases to regulate cellular processes. It can be utilized in electrode-based experiments and is commonly employed in the field of Antibodies research. Additionally, the SSRP1 antibody has been found to exhibit genotoxic effects and shows potential as an anti-beta amyloid agent for combating amyloid protein-related disorders.

The Keratin 5 antibody is a powerful tool for researchers in the field of Life Sciences. It is a monoclonal antibody that specifically targets Keratin 5, a protein found in mesenchymal stem cells. This antibody can be used to study the growth factor emission and differentiation of these cells. It has been extensively validated for use in various applications, including immunohistochemistry, western blotting, and flow cytometry.

ICA1L antibody was raised using the middle region of ICA1L corresponding to a region with amino acids PVPSQSPKKLTRSPNNGNQDMSAWFNLFADLDPLSNPDAIGHSDDELLNA

CD117 antibody (Allophycocyanin-CY7) was raised in rat using murine CD117/c-Kit as the immunogen.

ATP5B antibody was raised using the C terminal of ATP5B corresponding to a region with amino acids MGKLVPLKETIKGFQQILAGEYDHLPEQAFYMVGPIEEAVAKADKLAEEH

Rat monoclonal CD147 antibody (PE)

Monoclonal Mouse anti-Human Cardiac Troponin I

The FAK antibody is a highly effective monoclonal antibody used in Life Sciences. It belongs to the family of antibodies targeting specific growth factors, such as trastuzumab and adalimumab. This antibody specifically targets CD33, a protein expressed on the surface of certain cells. By neutralizing CD33, the FAK antibody inhibits the growth and proliferation of these cells.

TARS antibody was raised using the N terminal of TARS corresponding to a region with amino acids PEYIYTRLEMYNILKAEHDSILAEKAEKDSKPIKVTLPDGKQVDAESWKT

The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug belonging to the rifamycins class. It is specifically designed to combat tuberculosis infections by targeting active compounds that exhibit bactericidal activity. Through its unique mechanism of action, this drug binds to DNA-dependent RNA polymerase, preventing transcription and replication, thus inhibiting bacterial growth. Extensive research has shown its high efficacy in human erythrocytes using a patch-clamp technique.

Rabbit polyclonal BTK antibody (Tyr551)

Myeloperoxidase antibody was raised in mouse using human myeloperoxidase as the immunogen.

The SH2B3 antibody is a valuable tool in the field of Life Sciences. It is an immobilized monoclonal antibody that specifically targets SH2B3, a protein involved in various cellular processes. This antibody can be used for research purposes, such as studying the role of SH2B3 in signal transduction pathways or investigating its interactions with other proteins.

The OR1D2 antibody is a highly specialized fibroin that exhibits cytotoxic properties. This antibody specifically targets TGF-beta, a key protein involved in various cellular processes. It also interacts with fibrinogen, a crucial protein for blood clotting. The OR1D2 antibody is available as both polyclonal and monoclonal antibodies, providing flexibility for different research needs. In addition, it has been shown to inhibit caspase-9 activity, an enzyme involved in apoptosis. Researchers in the life sciences field can utilize this antibody as a valuable tool for studying signal transduction pathways and family kinase inhibitors. Its immobilization capabilities make it ideal for binding proteins on surfaces or electrodes, facilitating various experimental setups.

STRAP antibody was raised using the C terminal of STRAP corresponding to a region with amino acids ASGSEDGTLRLWQTVVGKTYGLWKCVLPEEDSGELAKPKIGFPETTEEEL

SET 7/9 antibody was raised in mouse using recombinant human SET7/9 (1-366aa) purified from E. coli as the immunogen.

Armenian Hamster monoclonal CD29 antibody (biotin)

CD19 antibody was raised in mouse using CD19+ murine pre-B cell line as the immunogen.

SPTLC2 antibody was raised using the N terminal of SPTLC2 corresponding to a region with amino acids VLTYVGYGVLTLFGYLRDFLRYWRIEKCHHATEREEQKDFVSLYQDFENF

Purified Rabbit polyclonal CD32 antibody (Tyr292)

The p70S6 Kinase antibody is a highly effective monoclonal antibody that is used in various assays to detect and measure the activation of p70S6 kinase. It has been extensively tested and validated using human serum samples. This antibody specifically targets the activated form of p70S6 kinase, making it an essential tool for researchers studying cell signaling pathways and protein synthesis.

The Tetracycline antibody is a highly specific monoclonal antibody that binds to tetracycline, a broad-spectrum antibiotic. This antibody has a high receptor binding affinity and can be used in various applications, such as polymerase chain reactions (PCR), immunohistochemistry, and Western blotting. It specifically targets tetracycline residues in biological samples, allowing for the detection and quantification of this antibiotic. In addition to its use in research, the Tetracycline antibody has potential applications in the field of medicine. It can be used to study the cellular localization of tetracycline within cells or tissues, providing valuable insights into its mechanism of action. Furthermore, this antibody can be utilized to investigate protein-protein interactions involving tetracycline or its derivatives. The Tetracycline antibody is produced using advanced techniques in monoclonal antibody production. It exhibits high specificity and sensitivity, ensuring reliable and accurate results. This antibody is compatible with various sample types, including