Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,620 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(751 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,551 products)
- Metabolism Antibodies(279 products)
- Microbiology Antibodies(739 products)
- Signal Transduction(2,717 products)
- Tags & Cellular Markers(33 products)
Found 75447 products of "Primary Antibodies"
Tau antibody
The Tau antibody is a highly specialized antibody used in the field of Life Sciences. It is a monoclonal antibody that specifically targets and binds to Tau proteins. Tau proteins play a crucial role in maintaining the structure and function of nerve cells in the brain. However, in certain neurodegenerative diseases such as Alzheimer's disease, these proteins become abnormally phosphorylated and form tangles, leading to cognitive decline.
PPIL2 antibody
PPIL2 antibody was raised using a synthetic peptide corresponding to a region with amino acids GRVVGGFDVLTAMENVESDPKTDRPKEEIRIDATTVFVDPYEEADAQIAQ
HSPA1A antibody
The HSPA1A antibody is a monoclonal antibody that specifically targets the glycoprotein HSPA1A. This antibody has been shown to have multiple functions, including its ability to inhibit interferon and leukemia inhibitory factor signaling pathways. Additionally, it has been found to have antiphospholipid antibodies and antiviral activity. The HSPA1A antibody also acts as an inhibitor of dopamine release and exhibits cytotoxic effects on certain hormone peptides. Furthermore, it has been used as an anticoagulant in human serum and has been shown to target autoantibodies. With its diverse range of functions, the HSPA1A antibody holds great potential for various therapeutic applications.Claudin 11 antibody
Claudin 11 antibody was raised using a synthetic peptide corresponding to a region with amino acids VSFGYSLYAGWIGAVLCLVGGCVILCCAGDAQAFGENRFYYTAGSSSPTH
Purity:Min. 95%CEP55 antibody
CEP55 antibody was raised using the N terminal of CEP55 corresponding to a region with amino acids MSSRSTKDLIKSKWGSKPSNSKSETTLEKLKGEIAHLKTSVDEITSGKGK
SFPQ antibody
SFPQ antibody was raised using a synthetic peptide corresponding to a region with amino acids PVIVEPLEQLDDEDGLPEKLAQKNPMYQKERETPPRFAQHGTFEYEYSQR
SLC27A2 antibody
SLC27A2 antibody was raised using a synthetic peptide corresponding to a region with amino acids LLFRDETLTYAQVDRRSNQVARALHDHLGLRQGDCVALLMGNEPAYVWLW
Purity:Min. 95%AFP antibody
The AFP antibody is a highly specialized monoclonal antibody that has been developed for various applications in the field of biomedical research. This antibody specifically targets and binds to alpha-fetoprotein (AFP), a human protein that is commonly found in the serum of individuals with certain medical conditions.
NPDC1 antibody
NPDC1 antibody was raised using the N terminal of NPDC1 corresponding to a region with amino acids MATPLPPPSPRHLRLLRLLLSGLVLGAALRGAAAGHPDVAACPGSLDCAL
PPIA antibody
The PPIA antibody is a monoclonal antibody that specifically targets the extracellular domain of the protein peptidylprolyl isomerase A (PPIA). PPIA is an enzyme that plays a crucial role in protein folding and is involved in various cellular processes, including interleukin signaling and antiviral defense. The PPIA antibody has been extensively studied and shown to have high affinity binding to PPIA, making it a valuable tool for research in the Life Sciences field.
Goat anti Human Lambda Chain (Fab'2)
Goat anti-human lambda chain (Fab'2) was raised in goat using human l (lambda) light chain as the immunogen.
Purity:Min. 95%ATG16L1 antibody
ATG16L1 antibody was raised using a synthetic peptide corresponding to a region with amino acids RRQARLQKELAEAAKEPLPVEQDDDIEVIVDETSDHTEETSPVRAISRAA
QTRT1 antibody
QTRT1 antibody was raised using a synthetic peptide corresponding to a region with amino acids KDKPRYLMGVGYATDLVVCVALGCDMFDCVFPTRTARFGSALVPTGNLQL
ACADL antibody
The ACADL antibody is a neurotrophic factor monoclonal antibody that has shown promising results in various studies. This antibody acts as a growth factor and has the ability to promote cell survival and differentiation. It can be used in research settings to study the effects of neurotrophic factors on neuronal development and function.
Zfp472 antibody
Zfp472 antibody was raised in rabbit using the N terminal of Zfp472 as the immunogen
Purity:Min. 95%eIF2 alpha antibody
The eIF2 alpha antibody is a highly effective tool in the field of Life Sciences. This monoclonal antibody specifically targets and neutralizes the protein eIF2 alpha, which plays a crucial role in cellular processes such as translation initiation. By blocking the activity of eIF2 alpha, this antibody can be used to study its function and regulation in various biological systems.
Purity:Min. 95%
