Primary Antibodies

The RAF1 antibody is a monoclonal antibody that specifically targets elastase, an enzyme involved in the breakdown of proteins. It has been extensively studied in the field of Life Sciences and is widely used in research and diagnostic applications. This antibody can be used to detect elastase levels in various biological samples, including human serum. Additionally, it has been shown to have potential therapeutic applications, such as inhibiting the action of elastase in conditions like pancreatitis or chronic obstructive pulmonary disease (COPD). The RAF1 antibody can also be used in combination with other antibodies, such as insulin or anti-VEGF antibodies, to study the interactions between different growth factors and signaling pathways. Its versatility and specificity make it a valuable tool for scientists and researchers working in diverse areas of biomedical research.

Purified Rabbit polyclonal NDUFA4 antibody

Mouse monoclonal NUDT6 antibody

Rat monoclonal CD5 antibody (allophycocyanin)

The Vav antibody is a polyclonal antibody that specifically targets the Vav protein. This antibody is widely used in life sciences research to study the role of Vav in various cellular processes. The Vav protein is involved in signal transduction pathways, particularly those mediated by TGF-beta and growth factors. It plays a crucial role in regulating cell proliferation, differentiation, and apoptosis.

Zfp472 antibody was raised in rabbit using the N terminal of Zfp472 as the immunogen

RABGGTA antibody was raised using the N terminal of RABGGTA corresponding to a region with amino acids ELAFTDSLITRNFSNYSSWHYRSCLLPQLHPQPDSGPQGRLPEDVLLKEL

Rabbit polyclonal HOXC6 antibody

Smpdl3a antibody was raised in rabbit using the N terminal of Smpdl3a as the immunogen

The PSA antibody is a specific antibody that is reactive to protein carbonyls. It has been shown to be effective in ultrasensitive detection of PSA in human serum. The antibody can be used for various applications, including electrochemical impedance and carbon electrode assays. It is commonly used in Life Sciences research and is available as both monoclonal and polyclonal antibodies. The PSA antibody is highly reliable and provides accurate results for the detection of messenger RNA expression levels. It can be used in combination with aluminum hydroxide adjuvant for enhanced immune response. Trust the PSA antibody for your research needs in the field of Antibodies.

KCNIP4 antibody was raised in Rabbit using Human KCNIP4 as the immunogen

The STAT3 antibody is a powerful tool used in Life Sciences research. It is designed to specifically target and bind to the STAT3 protein, which plays a crucial role in cell signaling and gene expression. This antibody can be used for various applications, including Western blotting, immunohistochemistry, and immunofluorescence.

Rabbit polyclonal SEC11A antibody

Mouse monoclonal PANK2 antibody

Rabbit polyclonal RNASEH1 antibody

Goat anti-cat IgG was raised in goat using feline IgG F(ab')2 fragment as the immunogen.

KRT18 antibody was raised in Rabbit using Human KRT18 as the immunogen

Rat monoclonal NGAL antibody (Biotin)

Rabbit polyclonal TRPS1 antibody

ABCB1 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.

Testosterone 3 antibody was raised in rabbit using testosterone-3 BSA as the immunogen.

The TEX14 antibody is a protein that acts as a growth factor, specifically targeting epidermal growth factor and hepatocyte growth inhibitory factor. It is an essential component in the field of Life Sciences and is widely used in research studies. The TEX14 antibody can be utilized as both a monoclonal and polyclonal antibody, making it versatile for various applications. Its high specificity allows for accurate detection and analysis of c-myc expression levels. Additionally, the TEX14 antibody has been found to be effective in detecting autoantibodies, making it valuable in diagnostic testing. With its robust capabilities, this antibody is an indispensable tool for researchers in the field.

Rabbit polyclonal CYB5 antibody (HRP)

The NSE antibody is a highly specialized monoclonal antibody that is used in various medical applications. It is commonly used in electrophoresis and high-dose chemotherapy procedures. This antibody specifically targets histone deacetylase inhibitors, which are involved in regulating gene expression and cell growth.

CD11b antibody (Spectral Red) was raised in rat using C57BL/10 murine splenic T-cells and concanavalin A-activted C57BL/10 splenocytes as the immunogen.

The NTR1 antibody is a polyclonal antibody that is commonly used in the field of Life Sciences. It is specifically designed to target and bind to NTR1, a protein that plays a crucial role in various biological processes. This antibody can be used for immobilization purposes, such as in immunoassays or for the detection of NTR1 in human serum samples.

Mouse monoclonal RNPEP antibody

TL1A antibody was raised in rabbit using highly pure recombinant human TL-1A as the immunogen.

Rabbit polyclonal NUDT19 antibody

Androgen receptor antibody was raised in rabbit using a synthetic peptide corresponding to residues M(1) E V Q L G L G R V Y P R P P S K T Y R G(21) C of human androgen receptor as the immunogen.

RAB40A antibody was raised using the middle region of RAB40A corresponding to a region with amino acids RPSKVLSLQDLCCRTIVSCTPVHLVDKLPLPSTLRSHLKSFSMAKGLNAR

Rabbit anti-human IgG was raised in rabbit using human IgG F(c) fragment as the immunogen.

The p73 antibody is a highly effective and versatile tool in the field of Life Sciences. This colloidal, activated antibody is known for its exceptional inhibitory properties against interleukin-6 (IL-6), a key pro-inflammatory cytokine. By neutralizing IL-6, the p73 antibody helps regulate immune responses and reduce inflammation.

The AMPD1 antibody is a highly specialized product in the field of Life Sciences. It is an activated monoclonal antibody that specifically targets and detects AMPD1, an enzyme involved in fatty acid metabolism. This antibody has been extensively tested and validated for its specificity and sensitivity in various applications.

FBXO24 antibody was raised using the middle region of FBXO24 corresponding to a region with amino acids QTLQDRTEKMKEIVGWMPLMAAQKDFFWEALDMLQRAEGGGGGVGPPAPE

AKR1B10 antibody was raised using a synthetic peptide corresponding to a region with amino acids NEHEVGEAIQEKIQEKAVKREDLFIVSKLWPTFFERPLVRKAFEKTLKDL

PNPLA3 antibody was raised using the C terminal of PNPLA3 corresponding to a region with amino acids CSPKGCPAETKAEATPRSILRSSLNFFLGNKVPAGAEGLSTFPSFSLEKS

Goat anti-mouse IgM (biotin) was raised in goat using murine IgM heavy chain as the immunogen.

Mouse monoclonal SHPRH antibody

UBE2J2 antibody was raised using a synthetic peptide corresponding to a region with amino acids GIQLLNGHAPGAVPNLAGLQQANRHHGLLGGALANLFVIVGFAAFAYTVK

Rabbit polyclonal TCF7 antibody

Mouse monoclonal STAT4 antibody

LRMP antibody was raised in Rabbit using Human LRMP as the immunogen

H2AFY2 antibody was raised using the middle region of H2AFY2 corresponding to a region with amino acids KKGGKKSKAAKPRTSKKSKPKDSDKEGTSNSTSEDGPGDGFTILSSKSLV

WDR5 antibody was raised in rabbit using the C terminal of WDR5 as the immunogen

The TPM2 antibody is a highly specialized protein kinase that plays a crucial role in various biological processes. It belongs to the family of polyclonal antibodies and is widely used in life sciences research. This antibody specifically targets β-catenin, a key protein involved in cell adhesion and signaling pathways. By binding to β-catenin, the TPM2 antibody can modulate its activity and regulate downstream cellular processes.

MVP antibody was raised using the N terminal of MVP corresponding to a region with amino acids MATEEFIIRIPPYHYIHVLDQNSNVSRVEVGPKTYIRQDNERVLFAPMRM