Primary Antibodies

Rabbit polyclonal APC5 antibody

Affinity purified Rabbit polyclonal MPI antibody

Rabbit polyclonal DOK7 antibody

The Aromatase antibody is a protein that belongs to the group of Polyclonal Antibodies. It plays a crucial role in the process of glycosylation, which is important for the proper functioning of various biological processes. This antibody can bind to specific targets and help in the detection and analysis of glycoproteins. Additionally, it has been shown to have cholinergic and acetyltransferase activities, making it valuable in research related to neurotransmission and signal transduction. The Aromatase antibody can also be used to detect autoantibodies and phosphatases in biological samples. Furthermore, studies have indicated its involvement in regulating interleukin-6 levels, suggesting its potential role in modulating immune responses. Overall, this monoclonal antibody is an essential tool for researchers in Life Sciences and offers insights into various cellular processes, including genotoxicity and interferon signaling pathways.

Affinity purified Rabbit polyclonal RASAL1 antibody

C14ORF21 antibody was raised using the middle region of C14Orf21 corresponding to a region with amino acids GGTILESERARPRGSQSSEAQKTPAQECKPADFEVPETFLNRLQDLSSSF

The GPR132 antibody is a specific antibody used in Life Sciences research. It is commonly used for the detection and analysis of GPR132 protein expression. This antibody can be utilized in various applications such as immunohistochemistry, western blotting, and flow cytometry. GPR132 is involved in several biological processes including the regulation of TGF-beta signaling, interferon production, and alpha-fetoprotein expression. The GPR132 antibody has also been used in studies investigating the therapeutic effects of antibodies such as adalimumab and growth factor inhibitors. Additionally, it has been employed to detect autoantibodies and evaluate their role in diseases associated with TNF-alpha and erythropoietin signaling pathways. With its high specificity and reliability, the GPR132 antibody is an essential tool for researchers exploring various aspects of cellular function and disease mechanisms.

RIPK4 antibody was raised using the N terminal of RIPK4 corresponding to a region with amino acids DGLFGTIAYLPPERIREKSRLFDTKHDVYSFAIVIWGVLTQKKPFADEKN

Rabbit polyclonal PA2G4 antibody

The CLCA1 antibody is a neutralizing monoclonal antibody that is widely used in Life Sciences research. It specifically targets CLCA1, a protein involved in various biological processes including the regulation of epidermal growth factor and hepatocyte growth factor. This antibody has been shown to inhibit the activity of CLCA1 by binding to its target site, preventing its interaction with other proteins or growth factors. In addition, the CLCA1 antibody can be used for immobilization studies or as a tool for detecting CLCA1 dimers in experimental settings. Its high specificity and affinity make it an essential tool for researchers studying the role of CLCA1 in different cellular processes.

Rabbit polyclonal BLOC1 antibody

Affinity purified Rabbit polyclonal ARHGEF18 antibody

Affinity purified Rabbit polyclonal CRLF1 antibody

The SATB1 antibody is a highly specialized growth factor that belongs to the class of antibodies. It is a monoclonal antibody that has cytotoxic and antiangiogenic properties, making it an effective proliferation inhibitor. In the field of Life Sciences, this antibody is widely used for its ability to neutralize various growth factors, including epidermal growth factor (EGF), transforming growth factor-beta (TGF-beta), and chemokines. The SATB1 antibody specifically targets low-molecular-weight endothelial growth factors, inhibiting their activity and preventing angiogenesis. This monoclonal antibody is a valuable tool in research and clinical applications related to cancer, inflammation, and other diseases involving abnormal cell growth.

Affinity purified Rabbit polyclonal SPR antibody

LIPT1 antibody was raised using the N terminal of LIPT1 corresponding to a region with amino acids NCFQLLCNCQVPAAGFKKTVKNGLILQSISNDVYQNLAVEDWIHDHMNLE

ACP6 antibody was raised in Rabbit using Human ACP6 as the immunogen

Affinity purified Rabbit polyclonal HNF1 alpha antibody

Rabbit polyclonal SYN1 antibody (Ser549)

The XRCC4 antibody is a monoclonal antibody used in Life Sciences research. It specifically targets the XRCC4 protein, which plays a crucial role in DNA repair and recombination. The antibody binds to the histidine-tagged XRCC4 protein, allowing for its detection and analysis in various experimental settings. This XRCC4 antibody is commonly used in studies involving pluripotent cells, collagen synthesis, lipoprotein lipase regulation, and immune response modulation. Additionally, it has been shown to interact with other proteins such as interferon, TGF-beta, and endothelial growth factors. The XRCC4 antibody offers researchers a valuable tool for investigating DNA repair mechanisms and understanding their implications in various biological processes.

Rabbit polyclonal Prostacyclin Receptor antibody

LGALS14 antibody was raised using the N terminal of LGALS14 corresponding to a region with amino acids MSSLPVPYTLPVSLPVGSCVIITGTPILTFVKDPQLEVNFYTGMDEDSDI

COL1A1 antibody is a monoclonal antibody that specifically targets the COL1A1 protein. It binds to the apical membrane of cells and can be used for various applications in life sciences research. This antibody has been extensively studied and validated for its specificity and sensitivity. It is commonly used in immunohistochemistry, immunofluorescence, and Western blotting experiments. The COL1A1 antibody can also be used in diagnostic assays to detect the presence of autoantibodies or as a therapeutic agent in pharmaceutical preparations. Additionally, this antibody has shown potential antiviral properties and can inhibit the growth factor signaling pathway, making it a versatile tool for researchers in various fields.

The Histone H2Ax antibody is a highly specialized monoclonal antibody used in Life Sciences research. This antibody specifically targets and binds to the acidic histone protein H2Ax, which plays a crucial role in DNA repair and damage response. By detecting the presence of H2Ax, researchers can gain valuable insights into various cellular processes, including fibrinogen activation, growth factor signaling, and multidrug resistance.

Rabbit polyclonal LATH antibody

Purified Polyclonal ENT1 antibody

Thyroid Peroxidase antibody is a monoclonal antibody used in Life Sciences research. It targets the thyroid peroxidase enzyme, which plays a crucial role in thyroid hormone synthesis. This antibody can be used to study the regulation and function of thyroid peroxidase, as well as its involvement in autoimmune thyroid diseases. Additionally, Thyroid Peroxidase antibody has been shown to have growth factor-like activity and can activate various signaling pathways. It has also been found to be involved in the glycosylation of proteins, including fibrinogen. Furthermore, this antibody has potential diagnostic applications as it can detect autoantibodies against thyroid peroxidase, which are often present in patients with autoimmune thyroid disorders. Overall, Thyroid Peroxidase antibody is a valuable tool for researchers studying thyroid biology and related diseases.

HOXC10 antibody was raised in Rabbit using Human HOXC10 as the immunogen

The MPT64 antibody is a highly specific monoclonal antibody that acts as an inhibitor against certain viruses and antibodies. It is commonly used in the field of Life Sciences for various applications. This antibody has been shown to have a strong affinity for interferon-gamma (IFN-gamma), a potent growth factor involved in immune response regulation. Additionally, it has the ability to bind to nuclear proteins and inhibit polymerase chain reactions (PCR). The MPT64 antibody can also be used to detect virus surface antigens in human serum samples, making it a valuable tool in diagnostic testing. With its electrode-activated properties, this antibody ensures accurate and reliable results in research and clinical settings.

This antibody reacts with heavy chains on human IgA (alpha chain) and.

The IGF-1R antibody is a powerful tool in the field of Life Sciences. It specifically targets the insulin-like growth factor-1 receptor, an important protein involved in cell growth and development. This antibody can be used in various research applications, including immunofluorescence, Western blotting, and immunohistochemistry.

Rabbit polyclonal TSR2 antibody

Affinity purified Rabbit polyclonal CKLFSF5 antibody

The Calretinin antibody is a highly specialized monoclonal antibody that is used in the field of Life Sciences. It is designed to target and detect the presence of calretinin, a calcium-binding protein found in various tissues and cells. This antibody has been extensively tested and validated for its specificity and sensitivity.

The FADD antibody is a monoclonal antibody that targets α-syn, a protein associated with neurodegenerative diseases such as Parkinson's disease. It has been shown to neutralize the harmful effects of α-syn and reduce its accumulation in the brain. This antibody also inhibits endothelial growth factor and promotes the growth of mesenchymal stem cells, which are involved in tissue repair and regeneration. Additionally, the FADD antibody has been used to measure microvessel density in blood plasma samples using particle chemiluminescence emission. It is a valuable tool for researchers in the field of life sciences studying neurodegenerative diseases and angiogenesis.

GADD45A antibody was raised in rabbit using the C terminal of GADD45A as the immunogen

The FAM84B antibody is a monoclonal antibody that specifically targets the FAM84B protein. This protein is involved in various biological processes, including collagen synthesis and adiponectin production. By targeting this molecule, the FAM84B antibody can modulate these processes and potentially have therapeutic effects.

Mouse monoclonal Cytokeratin 5 + 8 antibody

ANAPC4 antibody was raised in Rabbit using Human ANAPC4 as the immunogen

The ENO1 antibody is a specific monoclonal antibody that targets the c-myc protein kinase. It has been shown to inhibit the growth factor signaling pathway and reduce microvessel density in monolayer cultures of MCF-7 cells. This antibody can be used for various applications, including immunohistochemistry, immunofluorescence, and Western blotting. It is highly sensitive and specific, making it an ideal tool for studying the expression and localization of ENO1 in different cell types. Additionally, this antibody has been used to detect autoantibodies against ENO1 in certain diseases, making it a valuable tool for diagnostic purposes. The ENO1 antibody is supplied as a polyclonal antibody and can be used with saponin or TGF-beta for enhanced staining results.

Please enquire for more information about Dengue Virus Type 1 Envelope Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page

Monoclonal antibody against RANKL; anti-resorptive agent for osteoperosis treatment

CA 125 antibody (biotin) was raised in mouse using affinity pure human CA 125 antigen as the immunogen.

Cortisol antibody was raised in mouse using cortisol-3 BSA as the immunogen.