Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,620 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(751 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,551 products)
- Metabolism Antibodies(279 products)
- Microbiology Antibodies(739 products)
- Signal Transduction(2,717 products)
- Tags & Cellular Markers(33 products)
Found 75447 products of "Primary Antibodies"
WDR4 antibody
WDR4 antibody was raised using the C terminal of WDR4 corresponding to a region with amino acids AGADASFSSLYKATFDNVTSYLKKKEERLQQQLEKKQRRRSPPPGPDGHA
Plasminogen antibody (HRP)
Plasminogen antibody (HRP) was raised in goat using human plasminogen purified from plasma as the immunogen.RGS13 antibody
RGS13 antibody was raised using the middle region of RGS13 corresponding to a region with amino acids WSRISRAKKLYKIYIQPQSPREINIDSSTRETIIRNIQEPTETCFEEAQK
ERK1/2 antibody
ERK 1/2 antibody was raised in Mouse using a purified recombinant fragment of human MAPK1 expressed in E. coli as the immunogen.CD4 antibody (FITC)
CD4 antibody (FITC) was raised in rat using cloned murine CTL line V4 as the immunogen.
IQCE antibody
IQCE antibody was raised using the middle region of IQCE corresponding to a region with amino acids KKMGSALLSLSRSVQELTEENQSLKEDLDRVLSTSPTISKTQGYVEWSKP
ERG antibody
The ERG antibody is a highly specialized monoclonal antibody that is used in Life Sciences research. It specifically targets the ERG protein, which plays a critical role in cellular processes such as collagen production and TGF-beta1 signaling. This antibody can be used for various applications, including immunohistochemistry, western blotting, and enzyme-linked immunosorbent assays (ELISA). The ERG antibody is designed to provide accurate and reliable results, ensuring the highest level of specificity and sensitivity. It can be used with various enzyme substrates and detection systems to achieve optimal performance. Whether you are studying cell signaling pathways or investigating disease mechanisms, the ERG antibody is an invaluable tool for your research needs. With its exceptional quality and performance, this antibody will help advance your scientific discoveries in the field of Life Sciences.
CD45 antibody (FITC)
CD45 antibody (FITC) was raised in mouse using chicken CD45 as the immunogen.
Purity:Min. 95%Molecular weight:0 g/molLectin antibody
Lectin antibody was raised in rabbit using jack bean concanavalin A lectin as the immunogen.Purity:Min. 95%NDFIP2 antibody
NDFIP2 antibody was raised using the middle region of NDFIP2 corresponding to a region with amino acids SFCITNTIAGRYGAICGFGLSLIKWILIVRFSDYFTGYFNGQYWLWWIFL
Helicobacter pylori antibody
Helicobacter pylori antibody was raised in mouse using purified H. pylori antigen as the immunogen.Rag1 antibody
Rag1 antibody was raised in rabbit using the C terminal of Rag1 as the immunogen
Purity:Min. 95%DDB1 antibody
The DDB1 antibody is a monoclonal antibody used in Life Sciences research. It is specifically designed to target and bind to DDB1, a protein involved in various cellular processes. This antibody is commonly used in hybridization experiments and immunohistochemistry studies to detect the presence and localization of DDB1 in different tissues and cell types. The DDB1 antibody has also been shown to have cytotoxic effects on human hepatocytes, making it a valuable tool for studying the role of DDB1 in liver diseases. Additionally, this antibody can be used in combination with other antibodies or growth factors to investigate the interactions between DDB1 and other proteins or signaling pathways. Whether you are conducting basic research or developing new therapeutic strategies, the DDB1 antibody is an essential tool for understanding the functions of this important protein.
CD3e antibody (Spectral Red)
CD3e antibody (Spectral Red) was raised in rat using CD3e as the immunogen.
Purity:Min. 95%Molecular weight:0 g/molDONSON antibody
DONSON antibody was raised using the middle region of DONSON corresponding to a region with amino acids DLITALISPTTRGLREAMRNEGIEFSLPLIKESGHKKETASGTSLGYGEE
CD11a antibody (PE)
CD11a antibody (PE) was raised in mouse using human CD11a (LFA-1a) as the immunogen.
Purity:Min. 95%Molecular weight:0 g/molalpha Synuclein antibody
The alpha Synuclein antibody is a powerful tool in the field of Life Sciences. It specifically targets alpha-synuclein, a protein that plays a crucial role in neurodegenerative disorders such as Parkinson's disease. This antibody can be used in various applications, including immunohistochemistry, Western blotting, and ELISA assays.
HHIPL1 antibody
HHIPL1 antibody was raised in rabbit using the C terminal of HHIPL1 as the immunogen
Purity:Min. 95%NUP153 antibody
NUP153 antibody was raised in mouse using nuclear matrix protein fraction prepared from rat liver nuclei as the immunogen.
Phosphotyrosine antibody
Phosphotyrosine antibody was raised in rabbit using Iodoacetylphosphotyrosine-KLH conjugate as the immunogen.
Purity:Min. 95%TIE2 antibody
The TIE2 antibody is a monoclonal antibody that targets the growth factor receptor TIE2. This receptor plays a crucial role in regulating angiogenesis and vascular endothelial cell function. By binding to TIE2, the antibody blocks the activation of downstream signaling pathways, inhibiting tumor growth and metastasis.
B7H4 antibody
The B7H4 antibody is a highly effective medicament that belongs to the class of monoclonal antibodies. It is widely used in the field of Life Sciences for its remarkable properties. The antibody complex specifically targets and binds to B7H4, a protein expressed on the surface of various cancer cells, including MDA-MB-231 breast cancer cells. This binding inhibits the growth and proliferation of cancer cells by interfering with their signaling pathways.
CD19 antibody (PE-CY7)
CD19 antibody (PE-CY5.5) was raised in mouse using human CD19 as the immunogen.
Purity:Min. 95%Molecular weight:0 g/molTRPM5 antibody
TRPM5 antibody was raised using the N terminal of TRPM5 corresponding to a region with amino acids EKHISEQRAGYGGTGSIEIPVLCLLVNGDPNTLERISRAVEQAAPWLILV
Purity:Min. 95%CYP2D6 antibody
The CYP2D6 antibody is a polyclonal antibody that specifically targets the CYP2D6 enzyme. This enzyme is responsible for metabolizing a wide range of drugs, including bufuralol and interferon. The CYP2D6 antibody recognizes immunodominant epitopes on the enzyme and can be used in various research applications.
Dengue Virus Type 1 Envelope Antigen, Recombinant
Please enquire for more information about Dengue Virus Type 1 Envelope Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page
Purity:Min. 95%Denosumab
CAS:Monoclonal antibody against RANKL; anti-resorptive agent for osteoperosis treatment
Purity:(Sec-Hplc) Min. 95 Area-%Color and Shape:Clear LiquidRef: 3D-BD165585
Discontinued productCA 125 antibody (biotin)
CA 125 antibody (biotin) was raised in mouse using affinity pure human CA 125 antigen as the immunogen.
