Primary Antibodies

PRAME antibody was raised using the N terminal of PRAME corresponding to a region with amino acids AMVQAWPFTCLPLGVLMKGQHLHLETFKAVLDGLDVLLAQEVRPRRWKLQ

Mouse monoclonal HLADQ antibody

ABCB1 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.

DEFB4A antibody was raised in rabbit using the N terminal of DEFB4A as the immunogen

PRKAR2A antibody was raised in rabbit using the middle region of PRKAR2A as the immunogen

Rabbit polyclonal CHRC1 antibody

The CTBP1 antibody is a polyclonal antibody that is used in Life Sciences research. It has a high affinity for the low-density lipoprotein receptor-related protein 1 (LRP1) and can be used to study its role in various cellular processes. The CTBP1 antibody has been shown to inhibit the binding of epidermal growth factor (EGF) to LRP1, suggesting that it may play a role in EGF signaling pathways. Additionally, this antibody has been used to detect autoantibodies against CTBP1 in patients with certain autoimmune diseases. The CTBP1 antibody can be used in various techniques such as immunohistochemistry, western blotting, and ELISA to detect and quantify CTBP1 expression levels. Its specificity and sensitivity make it an ideal tool for researchers studying the function of CTBP1 and its potential as a therapeutic target.

PPP1R3B antibody was raised in rabbit using the N terminal of PPP1R3B as the immunogen

Mouse monoclonal MIF4GD antibody

Affinity purified Rabbit polyclonal MYO1B antibody

RTN4 antibody was raised using the middle region of RTN4 corresponding to a region with amino acids RAYLESEVAISEELVQKYSNSALGHVNCTIKELRRLFLVDDLVDSLKFAV

MORF4L1 antibody was raised in Rabbit using Human MORF4L1 as the immunogen

DLC1 antibody was raised using the C terminal of DLC1 corresponding to a region with amino acids NLAVCLAPSLFHLNTLKRENSSPRVMQRKQSLGKPDQKDLNENLAATQGL

The GSTP1 antibody is a polyclonal antibody that specifically targets the glutathione S-transferase pi 1 (GSTP1) protein. This protein is an important member of the GST family, which plays a crucial role in detoxification processes within cells. The GSTP1 antibody is designed to recognize and bind to the GSTP1 protein, allowing for its detection and analysis in various biological samples.

The MMP10 antibody is a polyclonal antibody that is used in immunohistochemical studies to detect the presence of matrix metalloproteinase 10 (MMP10) protein. This antibody is widely used in life sciences research to study various cellular processes, including pluripotent stem cell differentiation and hematopoietic development. The MMP10 antibody can be used as a valuable tool for researchers to investigate the expression and localization of MMP10 in different tissues and cell types. It can also be used to inhibit the activity of MMP10 or as a therapeutic reagent in the development of new cytokine inhibitors. With its high specificity and sensitivity, the MMP10 antibody is an essential component for any researcher working in the field of molecular biology and immunology.

Goat polyclonal AFP antibody (Fab'2)

The XRCC4 antibody is a highly specific monoclonal antibody that has an inhibitory effect on the progesterone concentration in human serum. It exhibits strong antioxidant activity and has been shown to neutralize autoantibodies and anti-drug antibodies. The XRCC4 antibody is widely used in various assays, particularly in Life Sciences research, for its ability to detect and quantify specific proteins of interest. This monoclonal antibody is colloidal gold-labeled, making it suitable for use in immunohistochemical staining and other applications requiring high sensitivity and specificity. Additionally, the XRCC4 antibody has been found to be effective in detecting granulosa cell tumors due to its binding affinity with mesothelin, a protein commonly expressed in these types of tumors. Its versatility and reliability make it an essential tool for researchers studying steroid hormones and related biological processes.

The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections as it exhibits bactericidal activity. By binding to DNA-dependent RNA polymerase, this drug inhibits bacterial growth by preventing transcription and replication. Its potency has been demonstrated through a patch-clamp technique on human erythrocytes. The active form of this drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits their cell growth in culture.

Rabbit polyclonal TLE2 antibody

SLC27A2 antibody was raised using a synthetic peptide corresponding to a region with amino acids LLFRDETLTYAQVDRRSNQVARALHDHLGLRQGDCVALLMGNEPAYVWLW

AP1M1 antibody was raised in Rabbit using Human AP1M1 as the immunogen

CHKA antibody was raised using the middle region of CHKA corresponding to a region with amino acids LESVMFAILAERSLGPKLYGIFPQGRLEQFIPSRRLDTEELSLPDISAEI

AGFG2 antibody was raised in Rabbit using Human AGFG2 as the immunogen

Rabbit polyclonal TPH2 antibody (Ser19)

GALNS antibody was raised in Rabbit using Human GALNS as the immunogen

MFAP3L antibody was raised using the N terminal of MFAP3L corresponding to a region with amino acids MHDSGLLNITKVSFSDRGKYTCVASNIYGTVNNTVTLRVIFTSGDMGVYY

Affinity purified Rabbit polyclonal MYBPC2 antibody

The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug belonging to the class of rifamycins. It is highly effective in treating tuberculosis infections due to its bactericidal activity. This active compound works by binding to DNA-dependent RNA polymerase, inhibiting transcription and replication, thereby preventing the growth of bacteria. Its efficacy has been demonstrated through extensive studies using advanced techniques such as patch-clamp on human erythrocytes. The drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits their cell growth in culture.

DBR1 antibody was raised in Rabbit using Human DBR1 as the immunogen

Rabbit polyclonal PCDHA6 antibody

The AVEN antibody is a highly specialized monoclonal antibody that targets specific molecules in the body. It is particularly effective in binding to β-catenin, collagen, anti-mesothelin, and urokinase plasminogen activator. This antibody is widely used in Life Sciences research for its ability to detect and inhibit the activity of these target molecules.

Affinity purified Rabbit polyclonal DNAI2 antibody

Human growth hormone antibody (HRP) was raised in mouse using human growth hormone as the immunogen.

TM9SF1 antibody was raised using the N terminal of TM9SF1 corresponding to a region with amino acids EGVTHYKAGDPVILYVNKVGPYHNPQETYHYYQLPVCCPEKIRHKSLSLG

FBXO3 antibody was raised in Rabbit using Human FBXO3 as the immunogen

Rat PMN antibody (FITC) was raised in rabbit using rat PMNs as the immunogen.

The GLUR1 antibody is a reactive antibody that specifically targets the IL-1 receptor, an important component of the interleukin signaling pathway. This antibody is widely used in Life Sciences research to study the role of IL-1 in various biological processes. Additionally, it has been shown to inhibit the production of pancreatic glucagon, a hormone involved in regulating blood sugar levels.

Affinity purified Rabbit polyclonal HMMR antibody

ACHE antibody was raised in Rabbit using Human ACHE as the immunogen

The LCN2 antibody is a highly specialized antibody that targets sclerostin. It is available in both polyclonal and monoclonal forms, offering a wide range of options for researchers. The antibody has been shown to neutralize prorenin and inhibit glucose-6-phosphate activation, making it a valuable tool for studying these processes. Additionally, the LCN2 antibody can be used in various assays and experiments, thanks to its high specificity and affinity for the target antigen. Its activated colloidal gold conjugate allows for easy visualization and detection using techniques such as immunohistochemistry or Western blotting. Researchers can rely on the LCN2 antibody to provide accurate and reliable results in their studies.

Monoclonal antibody against RANKL; anti-resorptive agent for osteoperosis treatment

Please enquire for more information about Dengue Virus Type 1 Envelope Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page

Please enquire for more information about HBsAg Mouse Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page

CA 125 antibody (biotin) was raised in mouse using affinity pure human CA 125 antigen as the immunogen.

Cortisol antibody was raised in mouse using cortisol-3 BSA as the immunogen.