Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,620 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(751 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,551 products)
- Metabolism Antibodies(279 products)
- Microbiology Antibodies(740 products)
- Signal Transduction(2,717 products)
- Tags & Cellular Markers(33 products)
Found 75447 products of "Primary Antibodies"
RNF212 antibody
RNF212 antibody was raised using the middle region of RNF212 corresponding to a region with amino acids LCKKYSRETSQILEFQEKHRKRLLAFYREKISRLEESLRKSVLQIEQLQS
MVD antibody
The MVD antibody is a highly specialized product in the field of Life Sciences. It is a monoclonal antibody that has been developed using cutting-edge technology. This antibody specifically targets and binds to collagen, making it an essential tool for research and diagnostic purposes.
LOX antibody
The LOX antibody is a growth factor that belongs to the glycoprotein family. It is widely used in Life Sciences research for its ability to inhibit phosphatase activity. This monoclonal antibody can be used in various applications, such as Western blotting, immunohistochemistry, and flow cytometry. The LOX antibody specifically targets human serum and has been shown to interact with fibronectin, collagen, alpha-fetoprotein, dopamine, and other proteins. Its high specificity and affinity make it an excellent tool for studying the role of LOX in various biological processes. Whether you're investigating cancer development or tissue remodeling, the LOX antibody is a valuable asset in your research arsenal.
Mad2L1 antibody
Mad2L1 antibody is a highly specific monoclonal antibody that targets Mad2L1 protein. Mad2L1 is involved in various cellular processes, including cell cycle regulation and checkpoint control. This antibody can be used for research purposes in the field of Life Sciences to study the role of Mad2L1 in different biological pathways.
Donkey anti-Mouse IgG (H+L) biotin
Donkey ant-mouse IgG (H + L) secondary antibody biotinPurity:Min. 95%BMX antibody
BMX antibody was raised in Mouse using a purified recombinant fragment of human BMX expressed in E. coli as the immunogen.
EEN antibody
The EEN antibody is a glycoprotein that has cytotoxic properties and is known for its anti-glial fibrillary acidic protein (GFAP) activity. It belongs to the family of antibodies that target specific proteins involved in various biological processes. This antibody has been extensively studied in the field of Life Sciences and has shown promising results in research related to adipocytes, endothelial growth factors, and fatty acid metabolism. The EEN antibody is widely used in scientific studies and experiments to investigate the role of GFAP and its potential therapeutic applications. It is available as polyclonal antibodies, ensuring high specificity and sensitivity for accurate detection and analysis.
CMV ICP36 antibody
CMV ICP36 antibody was raised in mouse using cytomegalovirus major DNA binding protein ICP36 as the immunogen.Donkey anti Mouse IgG (H + L) (FITC)
This antibody reacts with heavy (gamma) chains on mouse IgG and light chains on all mouse immunoglobulins.
Purity:Min. 95%CD18 antibody
The CD18 antibody is a monoclonal antibody that targets endothelial growth and erythropoietin. It specifically binds to low density lipoprotein (LDL) receptors on the surface of cells, inhibiting their uptake of LDL cholesterol. This antibody has been extensively studied in the field of Life Sciences and has shown promising results in various applications.
Rat Thrombocyte antibody
Rat thrombocyte antibody was raised in rabbit using rat thrombocytes as the immunogen.
Purity:Min. 95%CD4 antibody
The CD4 antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It acts as an inhibitor, targeting coagulation factors and other active agents involved in various biological processes. This monoclonal antibody specifically binds to nuclear antigens, making it an effective tool for research and diagnostic purposes.
CTNNB1 antibody
The CTNNB1 antibody is a highly specific monoclonal antibody that is used in Life Sciences research. It specifically targets the CTNNB1 protein, also known as beta-catenin, which plays a crucial role in cell adhesion and signaling pathways. This antibody is produced using advanced techniques and has been extensively validated for its specificity and sensitivity.
STAT3 antibody
The STAT3 antibody is a powerful tool used in life sciences research to study the function and activity of the transcription factor STAT3. This antibody specifically recognizes and binds to the phosphorylated form of STAT3, allowing researchers to investigate its role in various cellular processes. The chromatin immunoprecipitation assay can be performed using this antibody to analyze the DNA binding activity of STAT3 and identify its target genes. Additionally, the STAT3 antibody has been shown to inhibit the growth factor-induced transmembrane conductance in certain cell types. It has also been implicated in neuroprotective effects and plays a crucial role in the regulation of cytokine family signaling pathways, such as interleukin-6. With its high specificity and potency, this polyclonal antibody is an essential tool for scientists studying signal transduction pathways mediated by STAT3.
OXSM antibody
OXSM antibody was raised using the middle region of OXSM corresponding to a region with amino acids HAVQRRARIYAEVLGYGLSGDAGHITAPDPEGEGALRCMAAALKDAGVQP
CHIT1 antibody
CHIT1 antibody was raised in Mouse using a purified recombinant fragment of CHIT1(aa22-137) expressed in E. coli as the immunogen.
SCYL3 antibody
SCYL3 antibody was raised using a synthetic peptide corresponding to a region with amino acids MGSENSALKSYTLREPPFTLPSGLAVYPAVLQDGKFASVFVYKRENEDKV
MTIF3 antibody
MTIF3 antibody was raised using the middle region of MTIF3 corresponding to a region with amino acids AVQGGKALMCVLRALSKNEEKAYKETQETQERDTLNKDHGNDKESNVLHQ
HNRPL antibody
HNRPL antibody was raised using the N terminal of HNRPL corresponding to a region with amino acids DTWDYTNPNLSGQGDPGSNPNKRQRQPPLLGDHPAEYGGPHGGYHSHYHD
Histamine H3 Receptor antibody
The Histamine H3 Receptor antibody is a highly specific monoclonal antibody used in Life Sciences research. It targets the histamine H3 receptor, which is involved in various physiological processes, including neurotransmission and immune responses. This antibody is designed to specifically recognize and bind to the histamine H3 receptor protein found in humans.
alpha Tubulin antibody
The alpha Tubulin antibody is a highly specialized diagnostic agent used in the field of Life Sciences. It belongs to the class of Polyclonal Antibodies and is specifically designed to target and bind to alpha tubulin, a protein that plays a crucial role in cell division and intracellular transport. This antibody has been extensively tested and validated for its genotoxic activity, making it an essential tool for researchers studying various cellular processes.
HBsAg Mouse Monoclonal Antibody
Please enquire for more information about HBsAg Mouse Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page
Purity:Min. 95%Dengue Virus Type 1 Envelope Antigen, Recombinant
Please enquire for more information about Dengue Virus Type 1 Envelope Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page
Purity:Min. 95%Denosumab
CAS:Monoclonal antibody against RANKL; anti-resorptive agent for osteoperosis treatment
Purity:(Sec-Hplc) Min. 95 Area-%Color and Shape:Clear LiquidRef: 3D-BD165585
Discontinued productCA 125 antibody (biotin)
CA 125 antibody (biotin) was raised in mouse using affinity pure human CA 125 antigen as the immunogen.
