Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,620 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(751 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,551 products)
- Metabolism Antibodies(279 products)
- Microbiology Antibodies(740 products)
- Signal Transduction(2,717 products)
- Tags & Cellular Markers(33 products)
Found 75459 products of "Primary Antibodies"
Prothrombin fragment 1 antibody
Prothrombin fragment 1 antibody was raised in sheep using human Prothrombin purified from plasma as the immunogen.
HBcAg antibody (Prediluted for IHC)
Rabbit polyclonal HBcAg antibody (Prediluted for IHC)Purity:Min. 95%CD45 antibody
CD45 antibody was raised in mouse using recombinant human CD45 (1029-1249aa) purified from E. coli as the immunogen.
Caspase 8 antibody
Caspase 8 antibody is a highly specific monoclonal antibody that targets caspase 8, an enzyme involved in programmed cell death. This antibody has been extensively tested and validated for its ability to detect and inhibit caspase 8 activity. It can be used in various life science research applications including immunohistochemistry, western blotting, and flow cytometry. The Caspase 8 antibody has been shown to effectively block the activity of caspase 8, making it a valuable tool for studying apoptosis and cell death pathways. Its high specificity ensures accurate and reliable results, making it an essential component in many research projects.
SIX1 antibody
The SIX1 antibody is a polyclonal antibody that specifically targets the SIX1 protein. This antibody is commonly used in research and diagnostic applications to detect the presence of SIX1 in various samples. It can be used in techniques such as immunohistochemistry, Western blotting, and ELISA.
NPM antibody
Nucleolar Protein NO38 antibody was raised in mouse using Nucleolar fraction prepared from Xenopus laevis oocytes as the immunogen.HPRT antibody
HPRT antibody was raised in mouse using recombinant human HPRT (1-218aa) purified from E. coli as the immunogen.Rabbit anti Rat IgG (H + L) (HRP)
Rabbit anti-rat IgG (H+L) (HRP) was raised in rabbit using rat IgG whole molecule as the immunogen.
Purity:Min. 95%CD56 antibody (FITC)
CD56 antibody (FITC) was raised in mouse using human CD56 as the immunogen.
Purity:Min. 95%CD62L antibody (Allophycocyanin-CY7)
CD62L antibody (Allophycocyanin-CY7) was raised in rat using C3H/eb cloned murine B lymphoma 38C-13 as the immunogen.
Purity:Min. 95%FBXO5 antibody
FBXO5 antibody was raised using the C terminal of FBXO5 corresponding to a region with amino acids ASVQKSAAQTSLKKDAQTKLSNQGDQKGSTYSRHNEFSEVAKTLKKNESL
WTAP antibody
The WTAP antibody is a powerful tool in life sciences research. It is an antibody that specifically targets the WTAP protein, which plays a crucial role in various cellular processes. This antibody has been extensively studied and validated for its high specificity and sensitivity.
HES1 antibody
The HES1 antibody is a highly activated monoclonal antibody used in Life Sciences research. It specifically targets and binds to HES1, a protein involved in various cellular processes. This antibody has been shown to inhibit the activity of interferon-gamma (IFN-γ), glutamate, and interleukin-6 (IL-6) signaling pathways. Additionally, it can be used for the visualization of actin filaments in cells due to its high specificity towards actin. The HES1 antibody has a high viscosity, making it ideal for applications that require long-term stability and minimal sample loss. Furthermore, this antibody exhibits cytotoxic effects on targeted cells, making it a valuable tool for studies involving cell viability and apoptosis.
GPR132 antibody
The GPR132 antibody is a specific antibody used in Life Sciences research. It is commonly used for the detection and analysis of GPR132 protein expression. This antibody can be utilized in various applications such as immunohistochemistry, western blotting, and flow cytometry. GPR132 is involved in several biological processes including the regulation of TGF-beta signaling, interferon production, and alpha-fetoprotein expression. The GPR132 antibody has also been used in studies investigating the therapeutic effects of antibodies such as adalimumab and growth factor inhibitors. Additionally, it has been employed to detect autoantibodies and evaluate their role in diseases associated with TNF-alpha and erythropoietin signaling pathways. With its high specificity and reliability, the GPR132 antibody is an essential tool for researchers exploring various aspects of cellular function and disease mechanisms.
MBP antibody
The MBP antibody is a highly specialized antibody that targets and neutralizes myelin basic protein (MBP). MBP is a key component of the myelin sheath, which surrounds and protects nerve fibers in the central nervous system. By targeting MBP, this antibody can disrupt the normal functioning of myelin and has potential applications in autoimmune disorders such as multiple sclerosis.
CBG antibody
The CBG antibody is a highly specialized antibody-drug that belongs to the class of polyclonal antibodies. It has been extensively studied in the field of Life Sciences and has shown promising results in various applications. This antibody specifically targets insulin-like growth factor and thrombocytopenia, making it a valuable tool for researchers studying these areas.
MIP1 beta antibody (biotin)
MIP1 beta antibody (biotin) was raised in rabbit using highly pure recombinant human MIP-1-beta as the immunogen.
CD74 antibody
The CD74 antibody is a monoclonal antibody commonly used in Life Sciences research. It specifically targets and binds to the CD74 protein, which plays a crucial role in immune responses. This antibody has been shown to inhibit the production of reactive oxygen species and interferon, making it a valuable tool for studying immune system regulation. Additionally, the CD74 antibody can be used to detect autoantibodies and analyze their interactions with cellular components. With its high affinity and specificity, this antibody provides reliable results in various applications such as immunohistochemistry, flow cytometry, and Western blotting. Researchers can trust the CD74 antibody to deliver accurate and reproducible results in their experiments.
BPGM antibody
The BPGM antibody is a powerful tool used in chemotherapy and various Life Sciences research applications. It belongs to the class of antibodies that specifically target BPGM (bisphosphoglycerate mutase), an enzyme involved in the metabolism of glucose. This antibody has high affinity for BPGM and can be used in various assays to detect its presence or measure its activity.
SH2 antibody
The SH2 antibody is a monoclonal antibody that specifically targets and neutralizes the activity of growth factors in the body. It is designed to bind to specific acid residues on these growth factors, preventing them from interacting with their receptors and initiating cellular responses. This antibody has been extensively studied in Life Sciences research and has shown promising results in inhibiting the activity of various growth factors, including TGF-beta, epidermal growth factor (EGF), and transferrin.
CD49d antibody (PE)
CD49d antibody (biotin) was raised in rat using the alpha-4 chain of the VLA-4 integrin heterodimer as the immunogen.
Purity:Min. 95%Ankyrin repeat domain 45 antibody
Affinity purified Rabbit polyclonal Ankyrin repeat domain 45 antibody
POSTN antibody
The POSTN antibody is a highly specialized monoclonal antibody used in Life Sciences research. It is designed to specifically target and neutralize the activity of periostin (POSTN), a growth factor protein involved in various cellular processes. This antibody has been extensively tested and proven to effectively bind to POSTN, inhibiting its function.
SET antibody
SET antibody was raised using the N terminal of SET corresponding to a region with amino acids IDEVQNEIDRLNEQASEEILKVEQKYNKLRQPFFQKRSELIAKIPNFWVT
Purity:Min. 95%MGC42174 antibody
MGC42174 antibody was raised using the N terminal Of Mgc42174 corresponding to a region with amino acids MSHPDYRMNLRPLGTPRGVSAVAGPHDIGASPGDKKSKNRSTRGKKKSIF
Denosumab
CAS:Monoclonal antibody against RANKL; anti-resorptive agent for osteoperosis treatment
Purity:(Sec-Hplc) Min. 95 Area-%Color and Shape:Clear LiquidRef: 3D-BD165585
Discontinued productDengue Virus Type 1 Envelope Antigen, Recombinant
Please enquire for more information about Dengue Virus Type 1 Envelope Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page
Purity:Min. 95%HBsAg Mouse Monoclonal Antibody
Please enquire for more information about HBsAg Mouse Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page
Purity:Min. 95%CA 125 antibody (biotin)
CA 125 antibody (biotin) was raised in mouse using affinity pure human CA 125 antigen as the immunogen.
